KEGG   Homo sapiens (human): 29072Help
Entry
29072             CDS       T01001                                 

Gene name
SETD2, HBP231, HIF-1, HIP-1, HSPC069, HYPB, KMT3A, LLS, SET2, p231HBP
Definition
(RefSeq) SET domain containing 2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    29072 (SETD2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     29072 (SETD2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     29072 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BYW2(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.31
AA seq 2564 aa AA seqDB search
MKQLQPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEI
GDTLSTAEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAAPLPAVIAES
TTVDSPPSSPPPPPPPAQATTLSSPAPVTEPVALPHTPITVLMAAPVPLPVDVAVRSLKE
PPIIIVPESLEADTKQDTISNSLEEHVTQILNEQADISSKKEDSHIGKDEEIPDSSKISL
SCKKTGSKKKSSQSEGIFLGSESDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKS
EDLGKPSRSKTDRDDKYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSERGSRTNLSYS
RSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSSSY
RDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTSENEAIKRCCSPPNELGFR
RGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSEL
RMINKNPEREKAGSPAPSNRLNDSPTLKKLDELPIFKSEFITHDSHDSIKELDSLSKVKN
DQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSVTGSELSPLVKACMLSSNG
FQNISRCKEKDLDDTCMLHKKSESPFRETEPLVSPHQDKLMSMPVMTVDYSKTVVKEPVD
TRVSCCKTKDSDIYCTLNDSNPSLCNSEAENIEPSVMKISSNSFMNVHLESKPVICDSRN
LTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSGIASSLQSLPPGIKVDSLTLLKC
GENTSPVLDAVLKSKKSSEFLKHAGKETIVEVGSDLPDSGKGFASRENRRNNGLSGKCLQ
EAQEEGNSILPERRGRPEISLDERGEGGHVHTSDDSEVVFSSCDLNLTMEDSDGVTYALK
CDSSGHAPEIVSTVHEDYSGSSESSNDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPM
EETSPCSSRSSQSYRHYSDHWEDERLESRRHLYEEKFESIASKACPQTDKFFLHKGTEKN
PEISFTQSSRKQIDNRLPELSHPQSDGVDSTSHTDVKSDPLGHPNSEETVKAKIPSRQQE
ELPIYSSDFEDVPNKSWQQTTFQNRPDSRLGKTELSFSSSCEIPHVDGLHSSEELRNLGW
DFSQEKPSTTYQQPDSSYGACGGHKYQQNAEQYGGTRDYWQGNGYWDPRSGRPPGTGVVY
DRTQGQVPDSLTDDREEEENWDQQDGSHFSDQSDKFLLSLQKDKGSVQAPEISSNSIKDT
LAVNEKKDFSKNLEKNDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQGETSVPP
GSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCE
CTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKK
GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQK
GNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFC
GSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSR
LMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEI
IKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPDP
STKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEE
EELQSQQLLPQQLPECKVDSETNIEASKLPTSEPEADAEIEPKESNGTKLEEPINEETPS
QDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTTTER
GRDAVGFRDQTPAPKTPNRSRERDPDKQTQNKEKRKRRSSLSPPSSAYERGTKRPDDRYD
TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAP
HHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAP
PPVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQSV
SVQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAH
PQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARD
PEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKASKKPKTAEA
DTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKE
LKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7695 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgcagccgcagccgcctccgaagatgggggatttctacgacccggagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggtttc
atcaaaggaccaatgttcaaaggtgttgcttctagtcgatttttgcccaaaggcaccaaa
acaaaagttaatttggaagaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttgcagaataggtttctcactgcacttggcaatgaaaagcaaagtgatact
ccaaaccctccagctgtacctcttcaggtagactcgactcctaaaatgaaaatggaaatt
ggtgataccttatctactgcagaagaatcttccccaccaaagtcaagggtggaattgggc
aaaattcattttaagaaacatctgcttcatgtaacatccaggccactgctggctactacc
acagcagtagcatctccacctactcatgcagcaccattaccagcagtgatagcagaatca
acaactgtagactcaccgccctcatctccgcctccaccgcctccacctgcccaagccaca
acactctcatcaccagcaccagtaacagagccagtggccttgccacatacaccaataaca
gttctaatggcagcaccagtacccttaccagtagatgtagcagttagatctctgaaagaa
ccaccaattataattgtaccagaatctttagaagcagatactaagcaggacactatatct
aatagtttagaagaacacgtaactcaaatattgaatgagcaagcagatatttcctcaaaa
aaagaagattcccatattgggaaggatgaagaaattccagatagttctaagattagtctg
agctgtaaaaaaacaggttctaagaagaaatcctcacaatctgaaggcatctttcttggt
tcagaatctgatgaagattctgtacggacttcttcaagtcaaagatcacatgatttaaaa
ttttcagcaagcattgaaaaggaaagagattttaaaaagagctcagcacctttaaaaagt
gaggatctagggaaaccttcacgatctaaaacagacagagatgataaatattttagctat
tcaaaacttgaaagagatactcggtatgtatcttcccgatgtagatcagaaagagagcga
cggcggagcagatctcactctaggtctgagagaggctctagaactaatttatcctattcc
aggtcagaacgatctcattattatgactctgatcgtcgctaccataggagctccccttat
cgagagaggacgcgctattctcggccatacacagataacagagcacgagagagttctgac
tcagaagaagagtataagaagacatactcaaggcgtacctcatctcattcctcttcttac
agagacctaaggacatcatcctattctaaatctgatcgggactgtaaaactgagacctct
tacttagagatggaaagaagaggcaagtattcttcaaaactagaaagagaatctaaaagg
acttcagaaaatgaagcaattaaaagatgttgttctccccctaatgaactgggattccga
cgagggtcatcatattctaagcatgacagtagtgcttcccgttataaatctaccctttca
aaacctatacccaagtctgataaatttaaaaattctttctgttgtacagaattaaatgaa
gaaatcaaacagtctcattcttttagtttacagacaccttgttcaaaaggtagtgaatta
agaatgattaataaaaatcctgaaagagaaaaggctgggtctccagctccatcaaatcga
ttaaatgattcacctactttaaaaaagctagatgaattgcctatttttaagtccgaattt
ataacacatgatagccatgatagtattaaggaattagactctttatctaaagtgaagaat
gatcaattaagaagtttttgtcccatagaattaaatataaatggatctcctggggcagaa
tctgatttggcaacattttgcacttctaaaactgatgctgttttaatgacttctgatgat
agtgtgactggatcggaattatcccctttggtcaaagcatgcatgctttcatcaaatgga
tttcagaatattagtaggtgcaaagaaaaagacttggatgatacctgcatgctgcataag
aagtcagaaagcccatttagagaaacagaacctctggtgtcaccacaccaagataaactc
atgtctatgccagttatgactgtggattattccaaaacagtagttaaagaaccagttgat
acgagggtttcttgctgcaaaaccaaagattcagacatatactgtactttgaacgatagc
aacccttctttgtgtaactctgaagctgaaaatattgagccttcagttatgaagatttct
tcaaatagctttatgaatgtgcatttggaatcaaaaccagttatatgtgatagtagaaat
ttgacagatcactcaaaatttgcatgtgaagaatataagcagagcatcggtagcactagt
tcagcttctgttaatcattttgatgatttatatcaacctattgggagttcaggtattgct
tcatctcttcagagtcttccaccaggaataaaggtggacagtctaactctcttgaaatgc
ggagagaacacatctccagttctggatgcagtgctaaagagtaaaaaaagttcagagttt
ttaaagcatgcagggaaagaaacaatagtagaagtaggtagtgaccttcctgattcagga
aagggatttgcttccagggagaacaggcgtaataatgggttatctgggaaatgtttgcaa
gaggctcaagaagaagggaattccatattgcctgaaagaagaggaagaccagaaatctct
ttagatgaaagaggagaaggaggacatgtgcatacttctgatgactcagaagttgtattt
tcttcttgtgatttgaatttaaccatggaagacagtgatggtgtaacttatgcattaaag
tgtgacagtagtggtcatgccccagaaattgtgtctacagttcatgaagattattctggc
tcttctgaaagttcaaatgatgaaagtgattcagaagatacagattcggatgatagcagt
attccaagaaaccgtctccagtctgttgtggttgtgccaaagaattctactttgcccatg
gaagaaacaagtccttgttcttctcggagcagtcaaagttatagacactattctgaccat
tgggaagatgagagattggagtcaaggagacatttgtatgaggaaaaatttgaaagtata
gcaagtaaagcctgtcctcaaactgataagtttttccttcataaaggaacagagaagaat
ccggaaatttcttttacacagtccagtagaaaacaaatagataatcgcctgcctgaactt
tctcatcctcagagtgatggggttgatagtacaagtcatacagatgtgaaatctgaccct
ctgggtcacccaaattcagaggaaaccgtgaaagccaaaataccttctaggcagcaagaa
gagctgccaatttattcttctgattttgaagatgtcccaaataagtcttggcaacagacc
actttccaaaacaggccagatagtagactgggaaaaacagaattgagtttttcttcctct
tgtgagataccacatgtggatggcttgcactcatcagaagagctcagaaacttaggttgg
gacttctctcaagaaaagccttctaccacgtatcagcaacctgacagtagctatggagct
tgtggtggacacaagtatcagcaaaatgcagaacagtatggtgggacacgtgattactgg
caaggcaatggttactgggatccaagatcaggtagacctcctggaactggggttgtgtat
gatcgaactcaaggacaagtaccagattccctaacagatgatcgtgaagaagaggagaat
tgggatcaacaggatggatcccatttttcagaccagtccgataaatttcttctatccctt
cagaaagacaaggggtcagtgcaagcacctgaaataagcagcaattccattaaggacact
ttagctgtgaatgaaaagaaagatttttcaaaaaacttagaaaaaaatgatatcaaagat
agagggcctcttaaaaaaaggaggcaggaaatagagagtgattctgaaagtgatggtgag
cttcaggacagaaagaaagttagagtggaggtagagcagggagagacatcagtgccccca
ggttcagcactggttgggccctcctgtgtcatggatgacttcagggacccacagcgatgg
aaggaatgtgccaagcaagggaaaatgccatgttactttgatcttattgaagaaaatgtt
tatttaacagaaagaaagaagaataaatctcatcgagatattaagcgaatgcagtgtgag
tgtacacctctttctaaagatgaaagagctcaaggtgaaatagcatgtggggaagattgt
cttaatcgtcttctcatgattgaatgttcttctcggtgtccaaatggggattattgttcc
aatagacggtttcagagaaaacagcatgcagatgtggaagtcatactcacagaaaagaaa
ggctggggcttgagagctgccaaagaccttccttcgaacacctttgtcctagaatattgt
ggagaggtactcgatcataaagagtttaaagctcgagtgaaggagtatgcacgaaacaaa
aacatccattactatttcatggccctgaagaatgatgagataatagatgccactcaaaaa
ggaaattgctctcgtttcatgaatcacagctgtgaaccaaattgtgaaacccaaaaatgg
actgtgaacggacaactgagggttgggttttttaccaccaaactggttccttcaggctca
gagttaacgtttgactatcagttccagagatatggaaaagaagcccagaaatgtttctgc
ggatcagccaattgccggggttacctgggaggagaaaacagagtcagcatcagagcagca
ggagggaaaatgaagaaggaacgatctcgtaagaaggattcagtggatggagagctagaa
gctctgatggaaaatggtgagggtctctctgataaaaaccaggtgctcagcttatcccgg
ctaatggttagaattgaaactttggagcagaaacttacctgtctggaactcatacagaac
acacactcacagtcctgcctgaagtcctttctggaacgtcatgggctgtctttgttgtgg
atctggatggcagagctaggtgacggccgggaaagtaaccagaagcttcaggaagagatt
ataaagactttggaacacttgcccattcctactaaaaatatgttggaggaaagcaaagta
cttccaattattcaacgctggtctcagactaagactgctgtccctccgttgagtgaagga
gatgggtattctagtgagaatacatcgcgtgctcatacaccactcaacacacctgatcct
tccaccaagctgagcacagaagctgacacagacactcccaagaaactaatgtttcgcaga
ctgaaaattataagtgaaaatagcatggacagtgcaatctctgatgcaaccagtgagcta
gaaggcaaggatggcaaagaggatcttgatcaattagaaaatgtccctgtagaggaagag
gaagaattgcagtcacaacagctactcccacaacagctgcctgaatgcaaagttgatagt
gaaaccaacatagaagctagtaagctacctacatctgaaccagaagctgacgctgaaata
gagcccaaagagagcaacggcacaaaactagaagaacctattaatgaagaaacaccatcc
caagatgaagaggagggtgtgtctgatgtggagagtgaaaggagccaagaacagccagat
aaaacagtggatataagtgatttggccaccaaactcctggacagttggaaagacctaaag
gaggtatatcgaattccaaagaaaagtcaaactgaaaaggaaaacacaacaactgaacga
ggaagggatgctgttggcttcagagatcaaacacctgccccgaagactcctaataggtca
agagagagagacccagacaagcaaactcaaaataaagagaaaaggaaacgaagaagctcc
ctctcaccaccctcttctgcctatgagcggggaacaaaaaggccagatgacagatatgat
acaccaacttctaaaaagaaagtacgaattaaagaccgcaataaactttctacagaggaa
cgccggaagttgtttgagcaagaggtggctcaacgggaggctcagaaacaacagcaacag
atgcagaacctgggaatgacatcaccactgccctatgactctcttggttataatgccccg
catcatccctttgctggttacccaccaggttatcccatgcaggcctatgtggatcccagc
aaccctaatgctggaaaggtgctcctgcccacacccagcatggacccagtgtgttctcct
gctccttatgatcatgctcagcccttggtgggacattctacagaacccctttctgcccct
ccaccagtaccagtggtgccacatgtggcagctcctgtggaagtttccagttcccagtat
gtggcccagagtgatggtgtagtacaccaagactccagcgttgctgtcttgccagtgccg
gcccccggcccagttcagggacagaattatagtgtttgggattcaaaccaacagtctgtc
agtgtacagcagcagtactctcctgcacagtctcaagcaaccatatattatcaaggacag
acatgtccaacagtctatggtgtgacatcaccttattcacagacaactccaccaattgta
cagagttatgcccagccaagtcttcagtatatccaggggcaacagattttcacagctcat
ccacaaggagtggtggtacagccagccgcagcagtgactacaatagttgcaccagggcag
cctcagcccttgcagccatctgaaatggttgtgacaaataatctcttggatctgccgccc
ccctctcctcccaaaccaaaaaccattgtcttacctcccaactggaagacagctcgagat
ccagaagggaagatttattactaccatgtgatcacaaggcagactcagtgggatcctcct
acttgggaaagcccaggagatgatgccagccttgagcatgaagctgagatggacctggga
actccaacatatgatgaaaaccccatgaaggcctcgaaaaagcccaagacagcagaagca
gacacctccagtgaactagcaaagaaaagcaaagaagtattcagaaaagagatgtcccag
ttcatcgtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaagaattacc
acaactgaagactttaaacatctggctcgcaagctgactcacggtgttatgaataaggag
ctgaagtactgtaagaatcctgaggacctggagtgcaatgagaatgtgaaacacaaaacc
aaggagtacattaagaagtacatgcagaagtttggggctgtttacaaacccaaagaggac
actgaattagagtga

DBGET integrated database retrieval system