KEGG   Homo sapiens (human): 2909Help
Entry
2909              CDS       T01001                                 

Gene name
ARHGAP35, GRF-1, GRLF1, P190-A, P190A, p190ARhoGAP, p190RhoGAP
Definition
Rho GTPase activating protein 35
Orthology
K05732  
glucocorticoid receptor DNA-binding factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2909 (ARHGAP35)
  Cellular commiunity
   04510 Focal adhesion
    2909 (ARHGAP35)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2909 (ARHGAP35)
   04670 Leukocyte transendothelial migration
    2909 (ARHGAP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 1499 aa AA seqDB search
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEIDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL
EKLRNERKRVEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGND
GLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
KVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP
ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggcaagaaagcaagatgtccgaattcccacctacaacatcagtgtggtggga
ttatctgggaccgagaaggaaaagggccagtgtgggattggaaagtcttgtttgtgcaac
cgcttcgtgcgcccgagtgctgacgagtttcacttggaccatacctccgtcctcagcacc
agtgactttggagggcgagtggtcaataatgaccactttctctactggggagaagttagc
cgctccctggaggattgtgtggaatgtaagatgcacattgtggagcagactgaatttatt
gatgatcagacttttcaacctcatcgaagcacggccctgcagccctatatcaagagagct
gctgcgaccaagcttgcatcagctgaaaaactcatgtacttttgcactgaccagctgggg
ctggagcaggactttgagcagaaacaaatgccagacggaaagctgctggttgatggtttt
cttcttggtattgatgttagcaggggcatgaataggaactttgatgaccagctcaagttt
gtctccaatctctacaatcagcttgcaaaaacaaaaaagcccatagtggtggtcctgact
aagtgtgacgaaggtgttgagcggtacattagagatgcacatacttttgccttaagcaaa
aagaacctccaggttgtggagacctcagcgagatccaatgtaaacgtggacttggctttc
agcaccttagtgcaactcattgataaaagtcggggaaagacaaaaatcattccttatttt
gaagctctcaagcagcagagtcagcagatagctacagcaaaagacaagtatgagtggctg
gtgagtcgcattgtgaaaaaccacaatgagaactggctgagtgtcagccgaaagatgcag
gcctctccagaataccaggactatgtctacctggaagggactcagaaagccaagaagctg
tttctacagcacatccaccgcctcaagcatgagcatatcgagcgtaggagaaagctgtac
ctggcagccctgccattagcttttgaagctcttatacctaatctagatgaaatagaccac
ctaagctgcataaaagccaaaaagctcttagaaaccaagccagaattcttgaagtggttt
gttgtgcttgaagagaccccatgggatgccaccagtcacattgacaacatggaaaacgaa
cggattccctttgatttaatggataccgtccctgcagagcagctatacgaggcccactta
gagaagctgaggaacgaaaggaaaagagttgagatgcgaagggcgtttaaagaaaacctg
gagacttctcctttcataactcccggaaagccttgggaagaggcccgtagttttattatg
aatgaggatttctaccagtggctggaggaatctgtatacatggatatttatggcaaacac
caaaagcaaattatagataaagcaaaggaagaatttcaggagttgcttttggaatattca
gaattgttttatgaactggagctggatgctaagcccagcaaggagaagatgggtgttatt
caggatgttctgggagaggaacagcgatttaaagcattacaaaagctccaagcagagcgt
gatgcccttattctgaaacacattcattttgtgtaccacccaacaaaggagacatgcccc
agctgcccagcttgtgtggacgctaagattgagcacttgattagttctcggtttatccgg
ccgtctgaccggaatcagaaaaattcactctctgaccctaacattgatagaatcaacttg
gttatattgggcaaagacggccttgcccgagagttggccaatgagattcgagctctttgt
acaaatgatgacaagtatgtgatagatggtaaaatgtatgagctttccctgaggccaata
gaggggaatgtcaggcttcctgtgaactctttccagacgccaacatttcagccccacggc
tgtctctgcctttacaattcaaaggaatcgctatcctatgtagtggaaagtatagagaag
agtagagagtccacgctgggccggcgggataatcatttagtccatctcccccttacatta
attttggttaacaagagaggagacaccagtggagagactctgcatagcttaatacagcaa
ggtcaacaaattgctagcaaacttcagtgtgtctttctcgaccctgcttctgctggcatt
ggttacggacgcaacattaatgaaaagcaaatcagtcaagttttgaagggactcctggac
tctaagcgtaacttaaacctggtcagttctactgctagcatcaaagatttggctgatgtt
gatctgcgaattgttatgtgtctgatgtgtggagatccttttagtgcagatgacatactt
tttcctgtccttcagtcccaaacctgtaaatcttcccattgtggaagcaacaactctgtt
ttacttgaactaccaatcggactgcacaagaagcggattgaactgtctgttctttcatac
cattcctcctttagcatcagaaagagccggttggttcatgggtacattgttttttattca
gccaaacgtaaggcctctttggctatgttacgtgcctttctttgtgaagtgcaggatatt
atccctattcagcttgtagcactcactgatggcgctgtagatgtcctggacaatgactta
agtagggaacagctaactgagggggaggagattgctcaagaaattgacggaaggttcaca
agcatcccctgtagccaaccccagcataaacttgagatctttcacccattttttaaagat
gtggtggaaaaaaagaacataatcgaggctactcatatgtacgataatgctgccgaggcc
tgtagcaccaccgaagaggtgtttaactccccccgggcaggatcaccgctctgcaactca
aacctgcaggattcagaagaagatatcgagccatcttacagcctgtttcgagaagacaca
tcactgccttctctgtccaaagaccattctaagctctctatggaactggagggaaatgat
gggctgtctttcattatgagcaattttgagagtaaactgaacaacaaagtacctccgcca
gtcaaaccaaagcctcctgtccattttgaaattacaaagggggatctatcttatttagac
caaggccatagggatggacagaggaagtctgtgtcttctagcccctggctgcctcaggat
gggtttgatccttctgactatgctgaacccatggatgctgtggtgaagccaaggaatgaa
gaagaaaacatatactccgtgccccatgacagcacccaaggcaaaatcatcaccattcgg
aatatcaacaaagcccagtccaacggcagcgggaatggttctgacagtgaaatggacacc
agctctctagagcgagggcgcaaggtttccatcgtgagcaagccagtgctgtacaggacg
agatgcacccggctggggcggtttgctagttaccggaccagcttcagcgtggggagtgat
gatgagctggggcccatccggaagaaagaggaggatcaggcatcccagggttataaaggg
gacaatgctgtcattccatacgaaacagacgaagacccgcggaggaggaatattcttcgc
agcctaaggaggaacactaagaaaccaaagcccaaaccccggccatccatcacaaaggca
acctgggagagtaactattttggggtgcccttaacaactgtcgtgactccagagaagccg
atccccatttttattgaaagatgtattgagtacattgaagccacaggactgagcacggaa
ggcatctaccgggtcagcgggaacaagtctgagatggagagtctgcagagacagtttgat
caagaccacaacctggacctggcagagaaagactttacggtgaataccgtggctggtgcc
atgaagagctttttctcagaactgcctgaccccctggtcccgtataacatgcagatcgac
ttggtggaagcacacaaaatcaacgaccgggagcagaagttgcatgcccttaaggaggta
ttaaagaaatttccaaaggaaaaccacgaagtcttcaagtatgtcatctctcacctaaac
aaggtcagccacaacaacaaggtgaatctcatgaccagcgagaacctctccatctgcttc
tggcccaccttgatgagacctgatttcagcactatggacgccctcacagccacgcgcacc
taccagacaatcattgaactctttatccagcagtgccccttcttcttctacaatcggccc
atcaccgagccccccggcgccaggcccagctccccctctgccgtggcttccaccgtcccc
ttcctcacttccacgcctgtcacaagtcagccgtcgcccccacagtcgcctccacccacc
ccccagtccccaatgcagccactgcttccctcccagcttcaagccgaacacacgctgtga

DBGET integrated database retrieval system