KEGG   Homo sapiens (human): 2909Help
Entry
2909              CDS       T01001                                 

Gene name
ARHGAP35, GRF-1, GRLF1, P190-A, P190A, p190ARhoGAP, p190RhoGAP
Definition
(RefSeq) Rho GTPase activating protein 35
  KO
K05732  
glucocorticoid receptor DNA-binding factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2909 (ARHGAP35)
  Cellular community - eukaryotes
   04510 Focal adhesion
    2909 (ARHGAP35)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2909 (ARHGAP35)
   04670 Leukocyte transendothelial migration
    2909 (ARHGAP35)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    2909 (ARHGAP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 1499 aa AA seqDB search
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEIDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL
EKLRNERKRVEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGND
GLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
KVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP
ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggcaagaaagcaagatgtccgaattcccacctacaacatcagtgtggtggga
ttatctgggaccgagaaggaaaagggccagtgtgggattggaaagtcttgtttgtgcaac
cgcttcgtgcgcccgagtgctgacgagtttcacttggaccatacctccgtcctcagcacc
agtgactttggagggcgagtggtcaataatgaccactttctctactggggagaagttagc
cgctccctggaggattgtgtggaatgtaagatgcacattgtggagcagactgaatttatt
gatgatcagacttttcaacctcatcgaagcacggccctgcagccctatatcaagagagct
gctgcgaccaagcttgcatcagctgaaaaactcatgtacttttgcactgaccagctgggg
ctggagcaggactttgagcagaaacaaatgccagacggaaagctgctggttgatggtttt
cttcttggtattgatgttagcaggggcatgaataggaactttgatgaccagctcaagttt
gtctccaatctctacaatcagcttgcaaaaacaaaaaagcccatagtggtggtcctgact
aagtgtgacgaaggtgttgagcggtacattagagatgcacatacttttgccttaagcaaa
aagaacctccaggttgtggagacctcagcgagatccaatgtaaacgtggacttggctttc
agcaccttagtgcaactcattgataaaagtcggggaaagacaaaaatcattccttatttt
gaagctctcaagcagcagagtcagcagatagctacagcaaaagacaagtatgagtggctg
gtgagtcgcattgtgaaaaaccacaatgagaactggctgagtgtcagccgaaagatgcag
gcctctccagaataccaggactatgtctacctggaagggactcagaaagccaagaagctg
tttctacagcacatccaccgcctcaagcatgagcatatcgagcgtaggagaaagctgtac
ctggcagccctgccattagcttttgaagctcttatacctaatctagatgaaatagaccac
ctaagctgcataaaagccaaaaagctcttagaaaccaagccagaattcttgaagtggttt
gttgtgcttgaagagaccccatgggatgccaccagtcacattgacaacatggaaaacgaa
cggattccctttgatttaatggataccgtccctgcagagcagctatacgaggcccactta
gagaagctgaggaacgaaaggaaaagagttgagatgcgaagggcgtttaaagaaaacctg
gagacttctcctttcataactcccggaaagccttgggaagaggcccgtagttttattatg
aatgaggatttctaccagtggctggaggaatctgtatacatggatatttatggcaaacac
caaaagcaaattatagataaagcaaaggaagaatttcaggagttgcttttggaatattca
gaattgttttatgaactggagctggatgctaagcccagcaaggagaagatgggtgttatt
caggatgttctgggagaggaacagcgatttaaagcattacaaaagctccaagcagagcgt
gatgcccttattctgaaacacattcattttgtgtaccacccaacaaaggagacatgcccc
agctgcccagcttgtgtggacgctaagattgagcacttgattagttctcggtttatccgg
ccgtctgaccggaatcagaaaaattcactctctgaccctaacattgatagaatcaacttg
gttatattgggcaaagacggccttgcccgagagttggccaatgagattcgagctctttgt
acaaatgatgacaagtatgtgatagatggtaaaatgtatgagctttccctgaggccaata
gaggggaatgtcaggcttcctgtgaactctttccagacgccaacatttcagccccacggc
tgtctctgcctttacaattcaaaggaatcgctatcctatgtagtggaaagtatagagaag
agtagagagtccacgctgggccggcgggataatcatttagtccatctcccccttacatta
attttggttaacaagagaggagacaccagtggagagactctgcatagcttaatacagcaa
ggtcaacaaattgctagcaaacttcagtgtgtctttctcgaccctgcttctgctggcatt
ggttacggacgcaacattaatgaaaagcaaatcagtcaagttttgaagggactcctggac
tctaagcgtaacttaaacctggtcagttctactgctagcatcaaagatttggctgatgtt
gatctgcgaattgttatgtgtctgatgtgtggagatccttttagtgcagatgacatactt
tttcctgtccttcagtcccaaacctgtaaatcttcccattgtggaagcaacaactctgtt
ttacttgaactaccaatcggactgcacaagaagcggattgaactgtctgttctttcatac
cattcctcctttagcatcagaaagagccggttggttcatgggtacattgttttttattca
gccaaacgtaaggcctctttggctatgttacgtgcctttctttgtgaagtgcaggatatt
atccctattcagcttgtagcactcactgatggcgctgtagatgtcctggacaatgactta
agtagggaacagctaactgagggggaggagattgctcaagaaattgacggaaggttcaca
agcatcccctgtagccaaccccagcataaacttgagatctttcacccattttttaaagat
gtggtggaaaaaaagaacataatcgaggctactcatatgtacgataatgctgccgaggcc
tgtagcaccaccgaagaggtgtttaactccccccgggcaggatcaccgctctgcaactca
aacctgcaggattcagaagaagatatcgagccatcttacagcctgtttcgagaagacaca
tcactgccttctctgtccaaagaccattctaagctctctatggaactggagggaaatgat
gggctgtctttcattatgagcaattttgagagtaaactgaacaacaaagtacctccgcca
gtcaaaccaaagcctcctgtccattttgaaattacaaagggggatctatcttatttagac
caaggccatagggatggacagaggaagtctgtgtcttctagcccctggctgcctcaggat
gggtttgatccttctgactatgctgaacccatggatgctgtggtgaagccaaggaatgaa
gaagaaaacatatactccgtgccccatgacagcacccaaggcaaaatcatcaccattcgg
aatatcaacaaagcccagtccaacggcagcgggaatggttctgacagtgaaatggacacc
agctctctagagcgagggcgcaaggtttccatcgtgagcaagccagtgctgtacaggacg
agatgcacccggctggggcggtttgctagttaccggaccagcttcagcgtggggagtgat
gatgagctggggcccatccggaagaaagaggaggatcaggcatcccagggttataaaggg
gacaatgctgtcattccatacgaaacagacgaagacccgcggaggaggaatattcttcgc
agcctaaggaggaacactaagaaaccaaagcccaaaccccggccatccatcacaaaggca
acctgggagagtaactattttggggtgcccttaacaactgtcgtgactccagagaagccg
atccccatttttattgaaagatgtattgagtacattgaagccacaggactgagcacggaa
ggcatctaccgggtcagcgggaacaagtctgagatggagagtctgcagagacagtttgat
caagaccacaacctggacctggcagagaaagactttacggtgaataccgtggctggtgcc
atgaagagctttttctcagaactgcctgaccccctggtcccgtataacatgcagatcgac
ttggtggaagcacacaaaatcaacgaccgggagcagaagttgcatgcccttaaggaggta
ttaaagaaatttccaaaggaaaaccacgaagtcttcaagtatgtcatctctcacctaaac
aaggtcagccacaacaacaaggtgaatctcatgaccagcgagaacctctccatctgcttc
tggcccaccttgatgagacctgatttcagcactatggacgccctcacagccacgcgcacc
taccagacaatcattgaactctttatccagcagtgccccttcttcttctacaatcggccc
atcaccgagccccccggcgccaggcccagctccccctctgccgtggcttccaccgtcccc
ttcctcacttccacgcctgtcacaagtcagccgtcgcccccacagtcgcctccacccacc
ccccagtccccaatgcagccactgcttccctcccagcttcaagccgaacacacgctgtga

DBGET integrated database retrieval system