KEGG   Homo sapiens (human): 29102Help
Entry
29102             CDS       T01001                                 

Gene name
DROSHA, ETOHI2, HSA242976, RANSE3L, RN3, RNASE3L, RNASEN
Definition
(RefSeq) drosha ribonuclease III
  KO
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    29102 (DROSHA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    29102 (DROSHA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     29102 (DROSHA)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     29102 (DROSHA)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   RNase
    29102 (DROSHA)
 Prokaryotic Type
  rRNA processing factors
   29102 (DROSHA)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     29102 (DROSHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NRR4(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.3
AA seq 1374 aa AA seqDB search
MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQYQYEPPSAPS
TTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRPPFPNHQMRHPFPVPPCFPPM
PPPMPCPNNPPVPGAPPGQGTFPFMMPPPSMPHPPPPPVMPQQVNYQYPPGYSHHNFPPP
SFNSFQNNPSSFLPSANNSSSPHFRHLPPYPLPKAPSERRSPERLKHYDDHRHRDHSHGR
GERHRSLDRRERGRSPDRRRQDSRYRSDYDRGRTPSRHRSYERSRERERERHRHRDNRRS
PSLERSYKKEYKRSGRSYGLSVVPEPAGCTPELPGEIIKNTDSWAPPLEIVNHRSPSREK
KRARWEEEKDRWSDNQSSGKDKNYTSIKEKEPEETMPDKNEEEEEELLKPVWIRCTHSEN
YYSSDPMDQVGDSTVVGTSRLRDLYDKFEEELGSRQEKAKAARPPWEPPKTKLDEDLESS
SESECESDEDSTCSSSSDSEVFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSA
KARRTGIRHSIYPGEEAIKPCRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIEYDDHEYI
FEGFSMFAHAPLTNIPLCKVIRFNIDYTIHFIEEMMPENFCVKGLELFSLFLFRDILELY
DWNLKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMHQILLYLLRCSKALVPEEEIA
NMLQWEELEWQKYAEECKGMIVTNPGTKPSSVRIDQLDREQFNPDVITFPIIVHFGIRPA
QLSYAGDPQYQKLWKSYVKLRHLLANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTV
ELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQLAMTHP
SHHLNFGMNPDHARNSLSNCGIRQPKYGDRKVHHMHMRKKGINTLINIMSRLGQDDPTPS
RINHNERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDR
FMLYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWLN
YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL
GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA
ITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQDWND
PKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQA
EMGAAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIKK
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagggaaacacatgtcacagaatgtcgttccacccgggacgagggtgtccccga
ggacgaggaggacatggagccagaccctcagcaccatcctttaggccccaaaatctgagg
ctgcttcaccctcagcagcctcctgtgcaatatcaatatgaacctccaagtgccccttcc
accactttctcaaactctccagcccccaattttctccctccacgaccagactttgtaccc
ttccccccacccatgcctccgtcagcgcaaggccctcttcccccctgcccaatcaggccg
cctttccccaaccaccagatgaggcaccccttcccagttcctccttgttttcctcccatg
ccaccaccaatgccttgtcctaataaccccccagtccctggggcacctcctggacaaggc
actttccccttcatgatgccccctccctccatgcctcatcccccgccccctccagtcatg
ccgcagcaggttaattatcagtaccctccgggctattctcaccacaacttcccacctccc
agttttaatagtttccagaacaaccctagttctttcctgcccagtgctaataacagcagt
agtcctcatttcagacatctccctccatacccactcccaaaggctcccagtgagagaagg
tccccagaaaggctgaaacactatgatgaccacaggcaccgagatcacagtcatgggcga
ggtgagaggcatcggtccctggatcggcgggagcgaggccgcagtcccgacaggagaaga
caagacagccggtacagatctgattatgaccgagggagaacaccatctcgccaccgcagc
tacgaacggagcagagagcgagaacgggagagacacaggcatcgagacaaccgaagatca
ccatctctggaaaggtcctacaaaaaagagtataagagatctggaaggagttacggttta
tcggttgttcctgaacctgctggatgcacaccagaattacctggggagattattaaaaat
acagattcttgggccccacccctggagattgtgaatcatcgctccccaagtagggagaag
aagagagctcgttgggaggaagaaaaagaccgttggagtgacaaccagagttctggcaaa
gacaagaactatacctcaatcaaggaaaaagagcccgaggagaccatgcctgacaagaat
gaggaggaagaagaagaacttcttaagcctgtgtggattcgatgcactcattcagaaaac
tactactccagtgaccccatggatcaggtgggagattctacagtggttggaacgagtagg
cttcgtgacttatatgacaaatttgaggaggagttggggagcaggcaagaaaaggccaaa
gctgctcggcctccgtgggaacctccaaagacgaagctcgatgaagatttagagagttcc
agtgaatccgagtgtgagtctgatgaggacagcacctgttctagcagctcagactctgaa
gtttttgacgttattgcagaaatcaaacgcaaaaaggcccaccctgaccgacttcatgat
gaactttggtacaacgatccaggccagatgaatgatggaccactctgcaaatgcagcgca
aaggcaagacgcacaggaattaggcacagcatttatcctggagaagaggccatcaagccc
tgtcgtcctatgaccaacaatgctggcagacttttccactaccggatcacagtctccccg
cctacgaactttttaactgacaggccaactgttatagaatacgatgatcacgagtatatc
tttgaaggattttctatgtttgcacatgcccccctgaccaatattccactgtgtaaagta
attagattcaacatagactacacgattcatttcattgaagagatgatgccggagaatttt
tgtgtgaaagggcttgaactcttttcactgttcctattcagagatattttggaattatat
gactggaatcttaaaggtcctttgtttgaagacagccctccctgctgcccaagatttcat
ttcatgccacgttttgtaagatttcttccagatggaggaaaggaagtgctgtccatgcac
cagattctcctgtacttgttaaggtgcagcaaagccctggtgcctgaggaggagattgcc
aatatgcttcagtgggaggagctggagtggcagaaatatgcagaagaatgcaaaggcatg
attgttaccaaccctgggacgaaaccaagctctgtccgtatcgatcaactggatcgtgaa
cagttcaaccccgatgtgattacttttccgattatcgtccactttgggatacgccctgca
cagttgagttatgcaggagacccacagtaccaaaaactgtggaagagttatgtgaaactt
cgccacctcctagcaaatagtcccaaagtcaaacaaactgacaaacagaagctggcacag
agggaggaagccctccaaaaaatacggcagaagaatacaatgagacgagaagtaacggtg
gagctaagtagccaaggattctggaaaactggcatccgttctgatgtctgtcagcatgca
atgatgctacctgttctgacccatcatatccgctaccaccaatgcctaatgcatttggac
aagttgataggatatactttccaagatcgttgtctgttgcagctggccatgactcatcca
agtcatcatttaaattttggaatgaatcctgatcatgccaggaattcattatctaactgt
ggaattcggcagcccaaatacggagacagaaaagttcatcacatgcacatgcggaagaaa
gggattaacaccttgataaatatcatgtcacgccttggccaagatgacccaactccctcg
aggattaaccacaatgaacggttggaattcctgggtgatgctgttgttgaatttctgacc
agcgtccatttgtactatttgtttcctagtctggaagaaggaggattagcaacctatcgg
actgccattgttcagaatcagcaccttgccatgctagcaaagaaacttgaactggatcga
tttatgctgtatgctcacgggcctgacctttgtagagaatcggaccttcgacatgcaatg
gccaattgttttgaagcgttaataggagctgtttacttggagggaagcctggaggaagcc
aagcagttatttggacgcttgctctttaatgatccggacctgcgcgaagtctggctcaat
tatcctctccacccactccaactacaagagccaaatactgatcgacaacttattgaaact
tctccagttctacaaaaacttactgagtttgaagaagcaattggagtaatttttactcat
gttcgacttctggcaagggcattcacattgagaactgtgggatttaaccatctgacccta
ggccacaatcagagaatggaattcctaggtgactccataatgcaactggtagccacagag
tacttattcattcatttcccagatcatcatgaaggacacttaactttgttgcgaagctct
ttggtgaataatagaactcaggccaaggtagcggaggagctgggcatgcaggagtacgcc
ataaccaacgacaagaccaagaggcctgtggcgcttcgcaccaagaccttggcggacctt
ttggaatcatttattgcagcgctgtacattgataaggatttggaatatgttcatactttc
atgaatgtctgcttctttccacgattgaaagagttcattttgaatcaggattggaatgac
cccaaatcccagcttcagcagtgttgcttgacacttaggacagaaggaaaagagccagac
attcctctgtacaagactctgcagacagtgggcccatcccatgcccgaacctacactgtg
gctgtttatttcaagggagaaagaataggctgtgggaaaggaccaagtattcagcaagcg
gaaatgggagcagcaatggatgcgcttgaaaaatataattttccccagatggcccatcag
aagcggttcatcgaacggaagtacagacaagagttaaaagaaatgaggtgggaaagagag
catcaagagagagagccagatgagactgaagacatcaagaaataa

DBGET integrated database retrieval system