KEGG   Homo sapiens (human): 29119Help
Entry
29119             CDS       T01001                                 

Gene name
CTNNA3, ARVD13, VR22
Definition
(RefSeq) catenin alpha 3
  KO
K05691  catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05213  Endometrial cancer
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    29119 (CTNNA3)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    29119 (CTNNA3)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    29119 (CTNNA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    29119 (CTNNA3)
   05226 Gastric cancer
    29119 (CTNNA3)
   05213 Endometrial cancer
    29119 (CTNNA3)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    29119 (CTNNA3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    29119 (CTNNA3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     29119 (CTNNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin HA2
Motif
Other DBs
NCBI-GeneID: 29119
NCBI-ProteinID: NP_001120856
OMIM: 607667
HGNC: 2511
Ensembl: ENSG00000183230
Vega: OTTHUMG00000018334
Pharos: Q9UI47(Tbio)
UniProt: Q9UI47 Q8WW10 A8K141
Position
10q21.3
AA seq 895 aa AA seqDB search
MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDELENLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
IALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNV
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgaaacaccaatcacattgaatatcgatcctcaggatctgcaggtccaaaca
ttcaccgtggagaagctactggagcctctcataatccaggttaccacacttgtaaactgt
ccccagaacccttccagcaggaaaaaaggacgttcgaaaagagccagtgtccttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgcccaggaagct
acagttttaaaggatgagcttacggcttcacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttacagatgacccctgttttctcccaaaaagggaggct
gtggttcaagctgcccgtgccttgctggctgcggtgacgagactccttatccttgcggac
atgattgatgtcatgtgcctcttgcaacatgtgtcagcttttcaaaggacatttgagtct
ctcaaaaatgttgccaacaaatctgacctccagaaaacctaccagaagcttgggaaggag
ctggaaaatttggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agagatgaaattgcaggagcccgagcttcactgaaggagaactctcccctcttgcattca
atttgttcagcttgtttggagcattctgatgttgcttccctcaaagcaagcaaggacaca
gtttgtgaagaaattcagaatgctctcaatgtaatttcaaatgcttcacaagggatccag
aatatgacaaccccaccagaacctcaggcagcaaccctgggaagtgcccttgatgagctg
gagaatttaattgtcctgaatccactcacagtaactgaggaggaaatacgaccatcacta
gagaaacgccttgaagccattatcagtggggctgctctgctggcggattcttcatgtacg
agggacttacaccgagagcggattatcgcagaatgcaacgccattcgccaggctcttcag
gatctgctttcagagtacatgaacaacgctggaaaaaaagaaaggagtaataccctgaat
attgctttagacaacatgtgtaagaagacaagagaccttcgcagacagctccgcaaggct
attatagatcatgtgtcagactctttcctggatacgacagtccctcttttggttctcatt
gaagctgctaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcatgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgtcaaaattgcagccaatcatttggaaaccttgtgtccacagattatt
aatgctgcacttgctttggctgcaagacccaaaagtcaagcggtcaaaaacaccatggaa
atgtacaagcgtacatgggagaatcatatacatgtcctcactgaagccgtagatgacatt
acaagcattgatgacttccttgctgtatctgaaagccatatcttggaagatgtcaacaag
tgtatcatagccttaagagaccaggatgctgataatttagaccgtgctgcgggtgctatc
agaggccgggcagcaagagttgctcacatcgtcacgggtgaaatggacagttacgagcca
ggggcttacacggaaggtgtaatgagaaatgttaacttccttacaagtactgtaattcct
gaatttgtaacacaagtgaatgttgccttggaagccttaagcaaaagctcattgaatgtg
ttggatgataatcaatttgtggacatctcaaagaagatctatgatacaattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgaccttgaa
gaggaacacgaggtccgcagtcacaccagcattcagaccgaagggaaaactgatagggct
aagatgactcaactgcctgaggcagaaaaagaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaagctggatgctgagattgagatatgggatgatacaagcaacgac
atcattgttctggccaagaacatgtgtatgatcatgatggagatgacagacttcactagg
ggcaaaggaccactaaagcatacaactgatgtgatctatgcagcgaaaatgatatcagaa
tcaggatcaaggatggatgtccttgctcggcagattgctaatcagtgcccagatccatct
tgtaaacaggacttgttggcctacctggaacagattaagttctactcccaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtcagct
ttggacagtgtcacatccctgatccaagcagccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcatccgaatccagagtcctgctggg
ccccggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaaacccttgattaaa
agagagaagccagaggaaacgtgtgcagctgtcagacgaggctcagcaaagaaaaaaatc
catccattgcaagtcatgagtgaatttagaggaagacaaatctactga

DBGET integrated database retrieval system