KEGG   Homo sapiens (human): 29119Help
Entry
29119             CDS       T01001                                 

Gene name
CTNNA3, ARVD13, VR22
Definition
catenin (cadherin-associated protein), alpha 3
Orthology
K05691  
catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Adherens junction
Tight junction
Leukocyte transendothelial migration
Bacterial invasion of epithelial cells
Pathways in cancer
Endometrial cancer
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    29119 (CTNNA3)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    29119 (CTNNA3)
   04530 Tight junction
    29119 (CTNNA3)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    29119 (CTNNA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    29119 (CTNNA3)
   05213 Endometrial cancer
    29119 (CTNNA3)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    29119 (CTNNA3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    29119 (CTNNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.2
AA seq 895 aa AA seqDB search
MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDELENLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
IALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNV
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgaaacaccaatcacattgaatatcgatcctcaggatctgcaggtccaaaca
ttcaccgtggagaagctactggagcctctcataatccaggttaccacacttgtaaactgt
ccccagaacccttccagcaggaaaaaaggacgttcgaaaagagccagtgtccttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgcccaggaagct
acagttttaaaggatgagcttacggcttcacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttacagatgacccctgttttctcccaaaaagggaggct
gtggttcaagctgcccgtgccttgctggctgcggtgacgagactccttatccttgcggac
atgattgatgtcatgtgcctcttgcaacatgtgtcagcttttcaaaggacatttgagtct
ctcaaaaatgttgccaacaaatctgacctccagaaaacctaccagaagcttgggaaggag
ctggaaaatttggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agagatgaaattgcaggagcccgagcttcactgaaggagaactctcccctcttgcattca
atttgttcagcttgtttggagcattctgatgttgcttccctcaaagcaagcaaggacaca
gtttgtgaagaaattcagaatgctctcaatgtaatttcaaatgcttcacaagggatccag
aatatgacaaccccaccagaacctcaggcagcaaccctgggaagtgcccttgatgagctg
gagaatttaattgtcctgaatccactcacagtaactgaggaggaaatacgaccatcacta
gagaaacgccttgaagccattatcagtggggctgctctgctggcggattcttcatgtacg
agggacttacaccgagagcggattatcgcagaatgcaacgccattcgccaggctcttcag
gatctgctttcagagtacatgaacaacgctggaaaaaaagaaaggagtaataccctgaat
attgctttagacaacatgtgtaagaagacaagagaccttcgcagacagctccgcaaggct
attatagatcatgtgtcagactctttcctggatacgacagtccctcttttggttctcatt
gaagctgctaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcatgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgtcaaaattgcagccaatcatttggaaaccttgtgtccacagattatt
aatgctgcacttgctttggctgcaagacccaaaagtcaagcggtcaaaaacaccatggaa
atgtacaagcgtacatgggagaatcatatacatgtcctcactgaagccgtagatgacatt
acaagcattgatgacttccttgctgtatctgaaagccatatcttggaagatgtcaacaag
tgtatcatagccttaagagaccaggatgctgataatttagaccgtgctgcgggtgctatc
agaggccgggcagcaagagttgctcacatcgtcacgggtgaaatggacagttacgagcca
ggggcttacacggaaggtgtaatgagaaatgttaacttccttacaagtactgtaattcct
gaatttgtaacacaagtgaatgttgccttggaagccttaagcaaaagctcattgaatgtg
ttggatgataatcaatttgtggacatctcaaagaagatctatgatacaattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgaccttgaa
gaggaacacgaggtccgcagtcacaccagcattcagaccgaagggaaaactgatagggct
aagatgactcaactgcctgaggcagaaaaagaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaagctggatgctgagattgagatatgggatgatacaagcaacgac
atcattgttctggccaagaacatgtgtatgatcatgatggagatgacagacttcactagg
ggcaaaggaccactaaagcatacaactgatgtgatctatgcagcgaaaatgatatcagaa
tcaggatcaaggatggatgtccttgctcggcagattgctaatcagtgcccagatccatct
tgtaaacaggacttgttggcctacctggaacagattaagttctactcccaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtcagct
ttggacagtgtcacatccctgatccaagcagccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcatccgaatccagagtcctgctggg
ccccggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaaacccttgattaaa
agagagaagccagaggaaacgtgtgcagctgtcagacgaggctcagcaaagaaaaaaatc
catccattgcaagtcatgagtgaatttagaggaagacaaatctactga

DBGET integrated database retrieval system