KEGG   Homo sapiens (human): 29126Help
Entry
29126             CDS       T01001                                 

Gene name
CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1
Definition
(RefSeq) CD274 molecule
  KO
K06745  
programmed cell death 1 ligand 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    29126 (CD274)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    CD80; CD80 antigen [KO:K05412]
     29126 (CD274)
    PDCD1, PD1; programmed cell death 1 [KO:K06744]
     29126 (CD274)
Cellular antigens [BR:hsa04090]
 Proteins
  29126 (CD274)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p24
AA seq 290 aa AA seqDB search
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggatatttgctgtctttatattcatgacctactggcatttgctgaacgcatttact
gtcacggttcccaaggacctatatgtggtagagtatggtagcaatatgacaattgaatgc
aaattcccagtagaaaaacaattagacctggctgcactaattgtctattgggaaatggag
gataagaacattattcaatttgtgcatggagaggaagacctgaaggttcagcatagtagc
tacagacagagggcccggctgttgaaggaccagctctccctgggaaatgctgcacttcag
atcacagatgtgaaattgcaggatgcaggggtgtaccgctgcatgatcagctatggtggt
gccgactacaagcgaattactgtgaaagtcaatgccccatacaacaaaatcaaccaaaga
attttggttgtggatccagtcacctctgaacatgaactgacatgtcaggctgagggctac
cccaaggccgaagtcatctggacaagcagtgaccatcaagtcctgagtggtaagaccacc
accaccaattccaagagagaggagaagcttttcaatgtgaccagcacactgagaatcaac
acaacaactaatgagattttctactgcacttttaggagattagatcctgaggaaaaccat
acagctgaattggtcatcccagaactacctctggcacatcctccaaatgaaaggactcac
ttggtaattctgggagccatcttattatgccttggtgtagcactgacattcatcttccgt
ttaagaaaagggagaatgatggatgtgaaaaaatgtggcatccaagatacaaactcaaag
aagcaaagtgatacacatttggaggagacgtaa

DBGET integrated database retrieval system