KEGG   Homo sapiens (human): 29126Help
Entry
29126             CDS       T01001                                 

Gene name
CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1
Definition
(RefSeq) CD274 molecule
  KO
K06745  programmed cell death 1 ligand 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Drug target
Atezolizumab: D10773
Avelumab: D10817
Durvalumab: D10808
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    29126 (CD274)
CD molecules [BR:hsa04090]
 Proteins
  29126 (CD274)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set C2-set_2 ig V-set Ig_2 C1-set Lep_receptor_Ig V-set_CD47 Herpes_gE
Motif
Other DBs
NCBI-GeneID: 29126
NCBI-ProteinID: NP_054862
OMIM: 605402
HGNC: 17635
Ensembl: ENSG00000120217
Vega: OTTHUMG00000019503
Pharos: Q9NZQ7(Tclin)
UniProt: Q9NZQ7
Structure
PDB: 

Jmol
Position
9p24.1
AA seq 290 aa AA seqDB search
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggatatttgctgtctttatattcatgacctactggcatttgctgaacgcatttact
gtcacggttcccaaggacctatatgtggtagagtatggtagcaatatgacaattgaatgc
aaattcccagtagaaaaacaattagacctggctgcactaattgtctattgggaaatggag
gataagaacattattcaatttgtgcatggagaggaagacctgaaggttcagcatagtagc
tacagacagagggcccggctgttgaaggaccagctctccctgggaaatgctgcacttcag
atcacagatgtgaaattgcaggatgcaggggtgtaccgctgcatgatcagctatggtggt
gccgactacaagcgaattactgtgaaagtcaatgccccatacaacaaaatcaaccaaaga
attttggttgtggatccagtcacctctgaacatgaactgacatgtcaggctgagggctac
cccaaggccgaagtcatctggacaagcagtgaccatcaagtcctgagtggtaagaccacc
accaccaattccaagagagaggagaagcttttcaatgtgaccagcacactgagaatcaac
acaacaactaatgagattttctactgcacttttaggagattagatcctgaggaaaaccat
acagctgaattggtcatcccagaactacctctggcacatcctccaaatgaaaggactcac
ttggtaattctgggagccatcttattatgccttggtgtagcactgacattcatcttccgt
ttaagaaaagggagaatgatggatgtgaaaaaatgtggcatccaagatacaaactcaaag
aagcaaagtgatacacatttggaggagacgtaa

DBGET integrated database retrieval system