KEGG   Homo sapiens (human): 2913Help
Entry
2913              CDS       T01001                                 

Gene name
GRM3, GLUR3, GPRC1C, MGLUR3, mGlu3
Definition
glutamate receptor, metabotropic 3
Orthology
K04605  
metabotropic glutamate receptor 2/3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Cocaine addiction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2913 (GRM3)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2913 (GRM3)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    2913 (GRM3)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [Table]
    2913 (GRM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.1-q21.2
AA seq 879 aa AA seqDB search
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgttgacaagactgcaagttcttaccttagctttgttttcaaagggattttta
ctctctttaggggaccataactttctaaggagagagattaaaatagaaggtgaccttgtt
ttagggggcctgtttcctattaacgaaaaaggcactggaactgaagaatgtgggcgaatc
aatgaagaccgagggattcaacgcctggaagccatgttgtttgctattgatgaaatcaac
aaagatgattacttgctaccaggagtgaagttgggtgttcacattttggatacatgttca
agggatacctatgcattggagcaatcactggagtttgtcagggcatctttgacaaaagtg
gatgaagctgagtatatgtgtcctgatggatcctatgccattcaagaaaacatcccactt
ctcattgcaggggtcattggtggctcttatagcagtgtttccatacaggtggcaaacctg
ctgcggctcttccagatccctcagatcagctacgcatccaccagcgccaaactcagtgat
aagtcgcgctatgattactttgccaggaccgtgccccccgacttctaccaggccaaagcc
atggctgagatcttgcgcttcttcaactggacctacgtgtccacagtagcctccgagggt
gattacggggagacagggatcgaggccttcgagcaggaagcccgcctgcgcaacatctgc
atcgctacggcggagaaggtgggccgctccaacatccgcaagtcctacgacagcgtgatc
cgagaactgttgcagaagcccaacgcgcgcgtcgtggtcctcttcatgcgcagcgacgac
tcgcgggagctcattgcagccgccagccgcgccaatgcctccttcacctgggtggccagc
gacggctggggcgcgcaggagagcatcatcaagggcagcgagcatgtggcctacggcgcc
atcaccctggagctggcctcccagcctgtccgccagttcgaccgctacttccagagcctc
aacccctacaacaaccaccgcaacccctggttccgggacttctgggagcaaaagtttcag
tgcagcctccagaacaaacgcaaccacaggcgcgtctgcgacaagcacctggccatcgac
agcagcaactacgagcaagagtccaagatcatgtttgtggtgaacgcggtgtatgccatg
gcccacgctttgcacaaaatgcagcgcaccctctgtcccaacactaccaagctttgtgat
gctatgaagatcctggatgggaagaagttgtacaaggattacttgctgaaaatcaacttc
acggctccattcaacccaaataaagatgcagatagcatagtcaagtttgacacttttgga
gatggaatggggcgatacaacgtgttcaatttccaaaatgtaggtggaaagtattcctac
ttgaaagttggtcactgggcagaaaccttatcgctagatgtcaactctatccactggtcc
cggaactcagtccccacttcccagtgcagcgacccctgtgcccccaatgaaatgaagaat
atgcaaccaggggatgtctgctgctggatttgcatcccctgtgaaccctacgaatacctg
gctgatgagtttacctgtatggattgtgggtctggacagtggcccactgcagacctaact
ggatgctatgaccttcctgaggactacatcaggtgggaagacgcctgggccattggccca
gtcaccattgcctgtctgggttttatgtgtacatgcatggttgtaactgtttttatcaag
cacaacaacacacccttggtcaaagcatcgggccgagaactctgctacatcttattgttt
ggggttggcctgtcatactgcatgacattcttcttcattgccaagccatcaccagtcatc
tgtgcattgcgccgactcgggctggggagttccttcgctatctgttactcagccctgctg
accaagacaaactgcattgcccgcatcttcgatggggtcaagaatggcgctcagaggcca
aaattcatcagccccagttctcaggttttcatctgcctgggtctgatcctggtgcaaatt
gtgatggtgtctgtgtggctcatcctggaggccccaggcaccaggaggtatacccttgca
gagaagcgggaaacagtcatcctaaaatgcaatgtcaaagattccagcatgttgatctct
cttacctacgatgtgatcctggtgatcttatgcactgtgtacgccttcaaaacgcggaag
tgcccagaaaatttcaacgaagctaagttcataggttttaccatgtacaccacgtgcatc
atctggttggccttcctccctatattttatgtgacatcaagtgactacagagtgcagacg
acaaccatgtgcatctctgtcagcctgagtggctttgtggtcttgggctgtttgtttgca
cccaaggttcacatcatcctgtttcaaccccagaagaatgttgtcacacacagactgcac
ctcaacaggttcagtgtcagtggaactgggaccacatactctcagtcctctgcaagcacg
tatgtgccaacggtgtgcaatgggcgggaagtcctcgactccaccacctcatctctgtga

DBGET integrated database retrieval system