KEGG   Homo sapiens (human): 2913Help
Entry
2913              CDS       T01001                                 

Gene name
GRM3, GLUR3, GPRC1C, MGLUR3, mGlu3
Definition
(RefSeq) glutamate metabotropic receptor 3
  KO
K04605  metabotropic glutamate receptor 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa05030  Cocaine addiction
Drug target
Pomaglumetad methionil (DG02201): D09949 D10896
Talaglumetad hydrochloride: D09008
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    2913 (GRM3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2913 (GRM3)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2913 (GRM3)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    2913 (GRM3)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    2913 (GRM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2913
NCBI-ProteinID: NP_000831
OMIM: 601115
HGNC: 4595
Ensembl: ENSG00000198822
Vega: OTTHUMG00000022884
Pharos: Q14832(Tchem)
UniProt: Q14832 A4D1D0
Structure
PDB: 

Jmol
Position
7q21.11-q21.12
AA seq 879 aa AA seqDB search
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgttgacaagactgcaagttcttaccttagctttgttttcaaagggattttta
ctctctttaggggaccataactttctaaggagagagattaaaatagaaggtgaccttgtt
ttagggggcctgtttcctattaacgaaaaaggcactggaactgaagaatgtgggcgaatc
aatgaagaccgagggattcaacgcctggaagccatgttgtttgctattgatgaaatcaac
aaagatgattacttgctaccaggagtgaagttgggtgttcacattttggatacatgttca
agggatacctatgcattggagcaatcactggagtttgtcagggcatctttgacaaaagtg
gatgaagctgagtatatgtgtcctgatggatcctatgccattcaagaaaacatcccactt
ctcattgcaggggtcattggtggctcttatagcagtgtttccatacaggtggcaaacctg
ctgcggctcttccagatccctcagatcagctacgcatccaccagcgccaaactcagtgat
aagtcgcgctatgattactttgccaggaccgtgccccccgacttctaccaggccaaagcc
atggctgagatcttgcgcttcttcaactggacctacgtgtccacagtagcctccgagggt
gattacggggagacagggatcgaggccttcgagcaggaagcccgcctgcgcaacatctgc
atcgctacggcggagaaggtgggccgctccaacatccgcaagtcctacgacagcgtgatc
cgagaactgttgcagaagcccaacgcgcgcgtcgtggtcctcttcatgcgcagcgacgac
tcgcgggagctcattgcagccgccagccgcgccaatgcctccttcacctgggtggccagc
gacggctggggcgcgcaggagagcatcatcaagggcagcgagcatgtggcctacggcgcc
atcaccctggagctggcctcccagcctgtccgccagttcgaccgctacttccagagcctc
aacccctacaacaaccaccgcaacccctggttccgggacttctgggagcaaaagtttcag
tgcagcctccagaacaaacgcaaccacaggcgcgtctgcgacaagcacctggccatcgac
agcagcaactacgagcaagagtccaagatcatgtttgtggtgaacgcggtgtatgccatg
gcccacgctttgcacaaaatgcagcgcaccctctgtcccaacactaccaagctttgtgat
gctatgaagatcctggatgggaagaagttgtacaaggattacttgctgaaaatcaacttc
acggctccattcaacccaaataaagatgcagatagcatagtcaagtttgacacttttgga
gatggaatggggcgatacaacgtgttcaatttccaaaatgtaggtggaaagtattcctac
ttgaaagttggtcactgggcagaaaccttatcgctagatgtcaactctatccactggtcc
cggaactcagtccccacttcccagtgcagcgacccctgtgcccccaatgaaatgaagaat
atgcaaccaggggatgtctgctgctggatttgcatcccctgtgaaccctacgaatacctg
gctgatgagtttacctgtatggattgtgggtctggacagtggcccactgcagacctaact
ggatgctatgaccttcctgaggactacatcaggtgggaagacgcctgggccattggccca
gtcaccattgcctgtctgggttttatgtgtacatgcatggttgtaactgtttttatcaag
cacaacaacacacccttggtcaaagcatcgggccgagaactctgctacatcttattgttt
ggggttggcctgtcatactgcatgacattcttcttcattgccaagccatcaccagtcatc
tgtgcattgcgccgactcgggctggggagttccttcgctatctgttactcagccctgctg
accaagacaaactgcattgcccgcatcttcgatggggtcaagaatggcgctcagaggcca
aaattcatcagccccagttctcaggttttcatctgcctgggtctgatcctggtgcaaatt
gtgatggtgtctgtgtggctcatcctggaggccccaggcaccaggaggtatacccttgca
gagaagcgggaaacagtcatcctaaaatgcaatgtcaaagattccagcatgttgatctct
cttacctacgatgtgatcctggtgatcttatgcactgtgtacgccttcaaaacgcggaag
tgcccagaaaatttcaacgaagctaagttcataggttttaccatgtacaccacgtgcatc
atctggttggccttcctccctatattttatgtgacatcaagtgactacagagtgcagacg
acaaccatgtgcatctctgtcagcctgagtggctttgtggtcttgggctgtttgtttgca
cccaaggttcacatcatcctgtttcaaccccagaagaatgttgtcacacacagactgcac
ctcaacaggttcagtgtcagtggaactgggaccacatactctcagtcctctgcaagcacg
tatgtgccaacggtgtgcaatgggcgggaagtcctcgactccaccacctcatctctgtga

DBGET integrated database retrieval system