KEGG   Homo sapiens (human): 2914Help
Entry
2914              CDS       T01001                                 

Gene name
GRM4, GPRC1D, MGLUR4, mGlu4
Definition
glutamate receptor, metabotropic 4
Orthology
K04607  
metabotropic glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Taste transduction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 912 aa AA seqDB search
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagagaggcttgggctggtggtgggcccggctgcccctttgcctgctcctc
agcctttacggcccctggatgccttcctccctgggaaagcccaaaggccaccctcacatg
aattccatccgcatagatggggacatcacactgggaggcctgttcccggtgcatggccgg
ggctcagagggcaagccctgtggagaacttaagaaggaaaagggcatccaccggctggag
gccatgctgttcgccctggatcgcatcaacaacgacccggacctgctgcctaacatcacg
ctgggcgcccgcattctggacacctgctccagggacacccatgccctcgagcagtcgctg
acctttgtgcaggcgctcatcgagaaggatggcacagaggtccgctgtggcagtggcggc
ccacccatcatcaccaagcctgaacgtgtggtgggtgtcatcggtgcttcagggagctcg
gtctccatcatggtggccaacatccttcgcctcttcaagataccccagatcagctacgcc
tccacagcgccagacctgagtgacaacagccgctacgacttcttctcccgcgtggtgccc
tcggacacgtaccaggcccaggccatggtggacatcgtccgtgccctcaagtggaactat
gtgtccacagtggcctcggagggcagctatggtgagagcggtgtggaggccttcatccag
aagtcccgtgaggacgggggcgtgtgcatcgcccagtcggtgaagataccacgggagccc
aaggcaggcgagttcgacaagatcatccgccgcctcctggagacttcgaacgccagggca
gtcatcatctttgccaacgaggatgacatcaggcgtgtgctggaggcagcacgaagggcc
aaccagacaggccatttcttctggatgggctctgacagctggggctccaagattgcacct
gtgctgcacctggaggaggtggctgagggtgctgtcacgatcctccccaagaggatgtcc
gtacgaggcttcgaccgctacttctccagccgcacgctggacaacaaccggcgcaacatc
tggtttgccgagttctgggaggacaacttccactgcaagctgagccgccacgccctcaag
aagggcagccacgtcaagaagtgcaccaaccgtgagcgaattgggcaggattcagcttat
gagcaggaggggaaggtgcagtttgtgatcgatgccgtgtacgccatgggccacgcgctg
cacgccatgcaccgtgacctgtgtcccggccgcgtggggctctgcccgcgcatggaccct
gtagatggcacccagctgcttaagtacatccgaaacgtcaacttctcaggcatcgcaggg
aaccctgtgaccttcaatgagaatggagatgcgcctgggcgctatgacatctaccaatac
cagctgcgcaacgattctgccgagtacaaggtcattggctcctggactgaccacctgcac
cttagaatagagcggatgcactggccggggagcgggcagcagctgccccgctccatctgc
agcctgccctgccaaccgggtgagcggaagaagacagtgaagggcatgccttgctgctgg
cactgcgagccttgcacagggtaccagtaccaggtggaccgctacacctgtaagacgtgt
ccctatgacatgcggcccacagagaaccgcacgggctgccggcccatccccatcatcaag
cttgagtggggctcgccctgggccgtgctgcccctcttcctggccgtggtgggcatcgct
gccacgttgttcgtggtgatcacctttgtgcgctacaacgacacgcccatcgtcaaggcc
tcgggccgtgaactgagctacgtgctgctggcaggcatcttcctgtgctatgccaccacc
ttcctcatgatcgctgagcccgaccttggcacctgctcgctgcgccgaatcttcctggga
ctagggatgagcatcagctatgcagccctgctcaccaagaccaaccgcatctaccgcatc
ttcgagcagggcaagcgctcggtcagtgccccacgcttcatcagccccgcctcacagctg
gccatcaccttcagcctcatctcgctgcagctgctgggcatctgtgtgtggtttgtggtg
gacccctcccactcggtggtggacttccaggaccagcggacactcgacccccgcttcgcc
aggggtgtgctcaagtgtgacatctcggacctgtcgctcatctgcctgctgggctacagc
atgctgctcatggtcacgtgcaccgtgtatgccatcaagacacgcggcgtgcccgagacc
ttcaatgaggccaagcccattggcttcaccatgtacaccacttgcatcgtctggctggcc
ttcatccccatcttctttggcacctcgcagtcggccgacaagctgtacatccagacgacg
acgctgacggtctcggtgagtctgagcgcctcggtgtccctgggaatgctctacatgccc
aaagtctacatcatcctcttccacccggagcagaacgtgcccaagcgcaagcgcagcctc
aaagccgtcgttacggcggccaccatgtccaacaagttcacgcagaagggcaacttccgg
cccaacggagaggccaagtctgagctctgcgagaaccttgaggccccagcgctggccacc
aaacagacttacgtcacttacaccaaccatgcaatctag

DBGET integrated database retrieval system