KEGG   Homo sapiens (human): 2915Help
Entry
2915              CDS       T01001                                 

Gene name
GRM5, GPRC1E, MGLUR5, mGlu5
Definition
glutamate receptor, metabotropic 5
Orthology
K04604  
metabotropic glutamate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Huntington's disease
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2915 (GRM5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2915 (GRM5)
 Cellular Processes
  Cell communication
   04540 Gap junction
    2915 (GRM5)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2915 (GRM5)
   04720 Long-term potentiation
    2915 (GRM5)
   04723 Retrograde endocannabinoid signaling
    2915 (GRM5)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    2915 (GRM5)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    2915 (GRM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q14.3
AA seq 1180 aa AA seqDB search
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLSSNGKSVTWAQNEKSSRGQHLWQR
LSIHINKKENPNQTAVIKPFPKSTESRGLGAGAGAGGSAGGVGATGGAGCAGAGPGGPES
PDAGPKALYDVAEAEEHFPAPARPRSPSPISTLSHRAGSASRTDDDVPSLHSEPVARSSS
SQGSLMEQISSVVTRFTANISELNSMMLSTAAPSPGVGAPLCSSYLIPKEIQLPTTMTTF
AEIQPLPAIEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDS
VDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccgggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcggtc
cgtgaacagtatggcattcagagagtggaggccatgctgcataccctggaaaggatcaat
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggactcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagaaggcttggtacgctgtgtggatggctcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaat
ttgctccagcttttcaacatacctcagattgcttactcagcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaggcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagccgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaaaatctacagtaatgcaggggagcagagctttgataagctg
ctgaagaagctcacaagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaagctccaatctcccgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccaccgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctatgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgccatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatacgatcctattcgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattactttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtacacatgcaaggcatgccaactggggtcttggcccactgat
gatctcacaggttgtgacttgatcccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctggccaccctgtttgttactgtagtc
ttcatcatttaccgtgatacaccagtagtcaagtcctcaagcagggaactctgctacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcgaagcccaaa
cagatttactgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacctaggagtt
gtcactccacttggatacaatggattgttgattttgagctgcaccttctatgcgttcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggtcagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaacgtgcgcagcgccttcaccacatct
accgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaagttccaatgga
aaatccgtcacgtgggcccagaatgagaagagcagccgggggcagcacctgtggcagcgc
ctgtccatccacatcaacaagaaagaaaaccccaaccaaacggccgtcatcaagcccttc
cccaagagcacggagagccgtggcctgggcgctggcgctggcgcaggcgggagcgctggg
ggcgtgggggccacgggcggtgcgggctgcgcaggcgccggcccaggcgggcccgagtcc
ccagacgccggccccaaggcgctgtatgatgtggccgaggctgaggagcacttcccggcg
cccgcgcggccgcgctcaccgtcgcccatcagcacgctgagccaccgcgcgggctcggcc
agccgcacggacgacgatgtgccgtcgctgcactcggagcctgtggcgcgcagcagctcc
tcgcagggctccctcatggagcagatcagcagtgtggtcacccgcttcacggccaacatc
agcgagctcaactccatgatgctgtccaccgcggcccccagccccggcgtcggcgccccg
ctctgctcgtcctacctgatccccaaagagatccagttgcccacgaccatgacgaccttt
gccgaaatccagcctctgccggccatcgaagtcacgggaggcgcgcagcccgcggcaggg
gcgcaggcggctggggacgcggcccgggagagccccgcggccggtcccgaggctgcggcc
gccaagccagacctggaggagctggtggctctcaccccgccgtcccccttcagagactcg
gtggactcggggagcacaacccccaactcgccagtgtccgagtcggccctctgtatcccg
tcgtctcccaaatatgacactcttatcataagagattacactcagagctcctcgtcgttg
tga

DBGET integrated database retrieval system