KEGG   Homo sapiens (human): 2916Help
Entry
2916              CDS       T01001                                 

Gene name
GRM6, CSNB1B, GPRC1F, MGLUR6, mGlu6
Definition
glutamate receptor, metabotropic 6
Orthology
K04608  
metabotropic glutamate receptor 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Disease
H00787  
Congenital stationary night blindness (CSNB)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2916 (GRM6)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2916 (GRM6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2916 (GRM6)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    2916 (GRM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
5q35
AA seq 877 aa AA seqDB search
MARPRRAREPLLVALLPLAWLAQAGLARAAGSVRLAGGLTLGGLFPVHARGAAGRACGQL
KKEQGVHRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGR
GDGDEVGVRCPGGVPPLRPAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPE
LSDSTRYDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREA
GGVCIAQSIKIPREPKPGEFSKVIRRLMETPNARGIIIFANEDDIRRVLEAARQANLTGH
FLWVGSDSWGAKTSPILSLEDVAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEF
WEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVYAIAHALHSMHQ
ALCPGHTGLCPAMEPTDGRMLLQYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNG
SASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHC
EACDGYRFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLSWSSPWAAPPLLLAVLGIVAT
TTVVATFVRYNNTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPGAAVCAARRLFLGLG
TTLSYSALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFSLTSLQVVGMIAWLGARP
PHSVIDYEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFN
EAKPIGFTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKT
YVILFHPEQNVQKRKRSLKATSTVAAPPKGEDAEAHK
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggccccggagagcccgggagccgctgctcgtggcgctgctgccgctggcgtgg
ctggcgcaggcgggcctggcgcgcgcggcgggctctgtgcgcctggcgggcggcctgacg
ctgggcggcctgttcccggtgcacgcgcggggcgcggcgggccgggcgtgcgggcagctg
aagaaggagcagggcgtgcaccggctggaggccatgctgtacgcgctggaccgcgtcaac
gccgaccccgagctgctgcccggcgtgcgcctgggcgcgcggctgctggacacctgctcg
cgggacacctacgcgctggagcaggcgctgagcttcgtgcaggcgctgatccgcggccgc
ggcgacggcgacgaggtgggcgtgcgctgcccgggaggcgtccctccgctgcgccccgcg
ccccccgagcgcgtcgtggccgtcgtgggcgcctcggccagctccgtctccatcatggtc
gccaacgtgctgcgcctgtttgcgataccccagatcagctatgcctccacagccccggag
ctcagcgactccacacgctatgacttcttctcccgggtggtgccacccgactcctaccag
gcgcaggccatggtggacatcgtgagggcactgggatggaactatgtgtccacgctggcc
tccgagggcaactatggcgaaagtggggttgaggccttcgttcagatctcccgagaggct
gggggggtctgtattgcccagtctatcaagattcccagggaaccaaagccaggagagttc
agcaaggtgatcaggagactcatggagacgcccaacgcccggggcatcatcatctttgcc
aatgaggatgacatcaggcgggtcctggaggcagctcgccaggccaacctgaccggccac
ttcctgtgggtcggctcagacagctggggagccaagacctcacccatcttgagcctggag
gacgtggccgttggggccatcaccatcctgcccaaaagggcctccatcgacggatttgac
cagtacttcatgactcgatccctggagaacaaccgcaggaacatctggttcgccgagttc
tgggaagagaattttaactgcaaactgaccagctcaggtacccagtcagacgattccacc
cgcaaatgcacaggcgaggaacgcatcggccgggactccacctacgagcaggagggcaag
gtgcagtttgtgattgatgcggtgtacgccattgcccacgccctccacagcatgcaccag
gcgctctgccctgggcacacaggcctgtgcccggcgatggaacccactgatgggcggatg
cttctgcagtacattcgagctgtccgcttcaatggcagcgcaggaacccctgtgatgttc
aacgagaacggagatgcgcccgggcggtacgacatcttccagtaccaggcgaccaatggc
agtgccagcagtggcgggtaccaggcagtgggccagtgggcagagaccctcagactggat
gtggaggccctgcagtggtctggcgacccccacgaggtgccctcgtctctgtgcagcctg
ccctgcgggccgggggagcggaagaagatggtgaagggcgtcccctgctgttggcactgc
gaggcctgtgacgggtaccgcttccaggtggacgagttcacatgcgaggcctgtcctggg
gacatgaggcccacgcccaaccacacgggctgccgccccacacctgtggtgcgcctgagc
tggtcctccccctgggcagccccgccgctcctcctggccgtgctgggcatcgtggccact
accacggtggtggccaccttcgtgcggtacaacaacacgcccatcgtccgggcctcgggc
cgagagctcagctacgtcctcctcaccggcatcttcctcatctacgccatcaccttcctc
atggtggctgagcctggggccgcggtctgtgccgcccgcaggctcttcctgggcctgggc
acgaccctcagctactctgccctgctcaccaagaccaaccgtatctaccgcatctttgag
cagggcaagcgctcggtcacaccccctcccttcatcagccccacctcacagctggtcatc
accttcagcctcacctccctgcaggtggtggggatgatagcatggctgggggcccggccc
ccacacagcgtgattgactatgaggaacagcggacggtggaccccgagcaggccagaggg
gtgctcaagtgcgacatgtcggatctgtctctcatcggctgcctgggctacagcctcctg
ctcatggtcacgtgcacagtgtacgccatcaaggcccgtggcgtgcccgagaccttcaac
gaggccaagcccatcggcttcaccatgtacaccacctgcatcatctggctggcattcgtg
cccatcttctttggcactgcccagtcagctgaaaagatctacatccagacaaccacgcta
accgtgtccttgagcctgagtgcctcggtgtccctcggcatgctctacgtacccaaaacc
tacgtcatcctcttccatccagagcagaatgtgcagaagcgaaagcggagcctcaaggcc
acctccacggtggcagccccacccaagggcgaggatgcagaggcccacaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system