KEGG   Homo sapiens (human): 2917Help
Entry
2917              CDS       T01001                                 

Gene name
GRM7, GLUR7, GPRC1G, MGLU7, MGLUR7
Definition
glutamate receptor, metabotropic 7
Orthology
K04608  
metabotropic glutamate receptor 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p26.1-p25.1
AA seq 915 aa AA seqDB search
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggtccagctgaggaagctgctccgcgtcctgactttgatgaagttcccctgctgcgtg
ctggaggtgctcctgtgcgcgctggcggcggcggcgcgcggccaggagatgtacgccccg
cactcaatccggatcgagggggacgtcaccctcggggggctgttccccgtgcacgccaag
ggtcccagcggagtgccctgcggcgacatcaagagggaaaacgggatccacaggctggaa
gcgatgctctacgccctggaccagatcaacagtgatcccaacctactgcccaacgtgacg
ctgggcgcgcggatcctggacacttgttccagggacacttacgcgctcgaacagtcgctt
actttcgtccaggcgctcatccagaaggacacctccgacgtgcgctgcaccaacggcgaa
ccgccggttttcgtcaagccggagaaagtagttggagtgattggggcttcggggagttcg
gtctccatcatggtagccaacatcctgaggctcttccagatcccccagattagttatgca
tcaacggcacccgagctaagtgatgaccggcgctatgacttcttctctcgcgtggtgcca
cccgattccttccaagcccaggccatggtagacattgtaaaggccctaggctggaattat
gtgtctaccctcgcatcggaaggaagttatggagagaaaggtgtggagtccttcacgcag
atttccaaagaggcaggtggactctgcattgcccagtccgtgagaatcccccaggaacgc
aaagacaggaccattgactttgatagaattatcaaacagctcctggacacccccaactcc
agggccgtcgtgatttttgccaacgatgaggatataaagcagatccttgcagcagccaaa
agagctgaccaagttggccattttctttgggtgggatcagacagctggggatccaaaata
aacccactgcaccagcatgaagatatcgcagaaggggccatcaccattcagcccaagcga
gccacggtggaagggtttgatgcctactttacgtcccgtacacttgaaaacaacagaaga
aatgtatggtttgccgaatactgggaggaaaacttcaactgcaagttgacgattagtggg
tcaaaaaaagaagacacagatcgcaaatgcacaggacaggagagaattggaaaagattcc
aactatgagcaggagggtaaagtccagttcgtgattgacgcagtctatgctatggctcac
gcccttcaccacatgaacaaggatctctgtgctgactaccggggtgtctgcccagagatg
gagcaagctggaggcaagaagttgctgaagtatatacgcaatgttaatttcaatggtagt
gctggcactccagtgatgtttaacaagaacggggatgcacctgggcgttatgacatcttt
cagtaccagaccacaaacaccagcaacccgggttaccgtctgatcgggcagtggacagac
gaacttcagctcaatatagaagacatgcagtggggtaaaggagtccgagagatacccgcc
tcagtgtgcacactaccatgtaagccaggacagagaaagaagacacagaaaggaactcct
tgctgttggacctgtgagccttgcgatggttaccagtaccagtttgatgagatgacatgc
cagcattgcccctatgaccagaggcccaatgaaaatcgaaccggatgccaggatattccc
atcatcaaactggagtggcactccccctgggctgtgattcctgtcttcctggcaatgttg
gggatcattgccaccatctttgtcatggccactttcatccgctacaatgacacgcccatt
gtccgggcatctgggcgggaactcagctatgttcttttgacgggcatctttctttgctac
atcatcactttcctgatgattgccaaaccagatgtggcagtgtgttctttccggcgagtt
ttcttgggcttgggtatgtgcatcagttatgcagccctcttgacgaaaacaaatcggatt
tatcgcatatttgagcagggcaagaaatcagtaacagctcccagactcataagcccaaca
tcacaactggcaatcacttccagtttaatatcagttcagcttctaggggtgttcatttgg
tttggtgttgatccacccaacatcatcatagactatgatgaacacaagacaatgaaccct
gagcaagccagaggggttctcaagtgtgacattacagatctccaaatcatttgctccttg
ggatatagcattcttctcatggtcacatgtactgtgtatgccatcaagactcggggtgta
cccgagaattttaacgaagccaagcccattggattcactatgtacacgacatgtatagta
tggcttgccttcattccaattttttttggcaccgctcaatcagcggaaaagctctacata
caaactaccacgcttacaatctccatgaacctaagtgcatcagtggcgctggggatgcta
tacatgccgaaagtgtacatcatcattttccaccctgaactcaatgtccagaaacggaag
cgaagcttcaaggcggtagtcacagcagccaccatgtcatcgaggctgtcacacaaaccc
agtgacagacccaacggtgaggcaaagaccgagctctgtgaaaacgtagacccaaacagc
cctgctgcaaaaaagaagtatgtcagttataataacctggttatctaa

DBGET integrated database retrieval system