KEGG   Homo sapiens (human): 2918Help
Entry
2918              CDS       T01001                                 

Gene name
GRM8, GLUR8, GPRC1H, MGLUR8, mGlu8
Definition
glutamate receptor, metabotropic 8
Orthology
K04608  
metabotropic glutamate receptor 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2918 (GRM8)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2918 (GRM8)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2918 (GRM8)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    2918 (GRM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31.3-q32.1
AA seq 908 aa AA seqDB search
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH
IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggtatgcgagggaaagcgatcagcctcttgcccttgtttcttcctcttgaccgccaag
ttctactggatcctcacaatgatgcaaagaactcacagccaggagtatgcccattccata
cgggtggatggggacattattttggggggtctcttccctgtccacgcaaagggagagaga
ggggtgccttgtggggagctgaagaaggaaaaggggattcacagactggaggccatgctt
tatgcaattgaccagattaacaaggaccctgatctcctttccaacatcactctgggtgtc
cgcatcctcgacacgtgctctagggacacctatgctttggagcagtctctaacattcgtg
caggcattaatagagaaagatgcttcggatgtgaagtgtgctaatggagatccacccatt
ttcaccaagcccgacaagatttctggcgtcataggtgctgcagcaagctccgtgtccatc
atggttgctaacattttaagactttttaagatacctcaaatcagctatgcatccacagcc
ccagagctaagtgataacaccaggtatgactttttctctcgagtggttccgcctgactcc
taccaagcccaagccatggtggacatcgtgacagcactgggatggaattatgtttcgaca
ctggcttctgaggggaactatggtgagagcggtgtggaggccttcacccagatctcgagg
gagattggtggtgtttgcattgctcagtcacagaaaatcccacgtgaaccaagacctgga
gaatttgaaaaaattatcaaacgcctgctagaaacacctaatgctcgagcagtgattatg
tttgccaatgaggatgacatcaggaggatattggaagcagcaaaaaaactaaaccaaagt
gggcattttctctggattggctcagatagttggggatccaaaatagcacctgtctatcag
caagaggagattgcagaaggggctgtgacaattttgcccaaacgagcatcaattgatgga
tttgatcgatactttagaagccgaactcttgccaataatcgaagaaatgtgtggtttgca
gaattctgggaggagaattttggctgcaagttaggatcacatgggaaaaggaacagtcat
ataaagaaatgcacagggctggagcgaattgctcgggattcatcttatgaacaggaagga
aaggtccaatttgtaattgatgctgtatattccatggcttacgccctgcacaatatgcac
aaagatctctgccctggatacattggcctttgtccacgaatgagtaccattgatgggaaa
gagctacttggttatattcgggctgtaaattttaatggcagtgctggcactcctgtcact
tttaatgaaaacggagatgctcctggacgttatgatatcttccagtatcaaataaccaac
aaaagcacagagtacaaagtcatcggccactggaccaatcagcttcatctaaaagtggaa
gacatgcagtgggctcatagagaacatactcacccggcgtctgtctgcagcctgccgtgt
aagccaggggagaggaagaaaacggtgaaaggggtcccttgctgctggcactgtgaacgc
tgtgaaggttacaactaccaggtggatgagctgtcctgtgaactttgccctctggatcag
agacccaacatgaaccgcacaggctgccagcttatccccatcatcaaattggagtggcat
tctccctgggctgtggtgcctgtgtttgttgcaatattgggaatcatcgccaccaccttt
gtgatcgtgacctttgtccgctataatgacacacctatcgtgagggcttcaggacgcgaa
cttagttacgtgctcctaacggggatttttctctgttattcaatcacgtttttaatgatt
gcagcaccagatacaatcatatgctccttccgacgggtcttcctaggacttggcatgtgt
ttcagctatgcagcccttctgaccaaaacaaaccgtatccaccgaatatttgagcagggg
aagaaatctgtcacagcgcccaagttcattagtccagcatctcagctggtgatcaccttc
agcctcatctccgtccagctccttggagtgtttgtctggtttgttgtggatcccccccac
atcatcattgactatggagagcagcggacactagatccagagaaggccaggggagtgctc
aagtgtgacatttctgatctctcactcatttgttcacttggatacagtatcctcttgatg
gtcacttgtactgtttatgccattaaaacgagaggtgtcccagagactttcaatgaagcc
aaacctattggatttaccatgtataccacctgcatcatttggttagctttcatccccatc
ttttttggtacagcccagtcagcagaaaagatgtacatccagacaacaacacttactgtc
tccatgagtttaagtgcttcagtatctctgggcatgctctatatgcccaaggtttatatt
ataatttttcatccagaacagaatgttcaaaaacgcaagaggagcttcaaggctgtggtg
acagctgccaccatgcaaagcaaactgatccaaaaaggaaatgacagaccaaatggcgag
gtgaaaagtgaactctgtgagagtcttgaaaccaacacttcctctaccaagacaacatat
atcagttacagcaatcattcaatctga

DBGET integrated database retrieval system