KEGG   Homo sapiens (human): 292Help
Entry
292               CDS       T01001                                 

Gene name
SLC25A5, 2F1, AAC2, ANT2, T2, T3
Definition
solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5
Orthology
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Parkinson's disease
Huntington's disease
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    292 (SLC25A5)
   04022 cGMP - PKG signaling pathway
    292 (SLC25A5)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    292 (SLC25A5)
   05016 Huntington's disease
    292 (SLC25A5)
  Infectious diseases
   05166 HTLV-I infection
    292 (SLC25A5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    292 (SLC25A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq24
AA seq 298 aa AA seqDB search
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcctggcaggtggagtggccgcagcc
atctccaagacggcggtagcgcccatcgagcgggtcaagctgctgctgcaggtgcagcat
gccagcaagcagatcactgcagataagcaatacaaaggcattatagactgcgtggtccgt
attcccaaggagcagggagttctgtccttctggcgcggtaacctggccaatgtcatcaga
tacttccccacccaggctcttaacttcgccttcaaagataaatacaagcagatcttcctg
ggtggtgtggacaagagaacccagttttggctctactttgcagggaatctggcatcgggt
ggtgccgcaggggccacatccctgtgttttgtgtaccctcttgattttgcccgtacccgt
ctagcagctgatgtgggtaaagctggagctgaaagggaattccgaggcctcggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaacgtgtct
gtgcagggtattatcatctaccgagccgcctacttcggtatctatgacactgcaaaggga
atgcttccggatcccaagaacactcacatcgtcatcagctggatgatcgcacagactgtc
actgctgttgccgggttgacttcctatccatttgacactgttcgccgccgcatgatgatg
cagtcagggcgcaaaggaactgacatcatgtacacaggcacgcttgactgctggcggaag
attgctcgtgatgaaggaggcaaagcttttttcaagggtgcatggtccaatgttctcaga
ggcatgggtggtgcttttgtgcttgtcttgtatgatgaaatcaagaagtacacataa

DBGET integrated database retrieval system