KEGG   Homo sapiens (human): 2920Help
Entry
2920              CDS       T01001                                 

Gene name
CXCL2, CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Definition
chemokine (C-X-C motif) ligand 2
Orthology
K05505  
C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Salmonella infection
Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    2920 (CXCL2)
   04668 TNF signaling pathway
    2920 (CXCL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2920 (CXCL2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    2920 (CXCL2)
   04062 Chemokine signaling pathway
    2920 (CXCL2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    2920 (CXCL2)
   05134 Legionellosis
    2920 (CXCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21
AA seq 107 aa AA seqDB search
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgcccctggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
aaggtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcagaaagcttgtctcaaccccgcatcgcccatggttaagaaaatcatcgaaaagatg
ctgaaaaatggcaaatccaactga

DBGET integrated database retrieval system