KEGG   Homo sapiens (human): 2921Help
Entry
2921              CDS       T01001                                 

Gene name
CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Definition
chemokine (C-X-C motif) ligand 3
Orthology
K05505  
C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Salmonella infection
Legionellosis
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 107 aa AA seqDB search
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgtccgtggtcactgaa
ctgcgctgccagtgcttgcagacactgcagggaattcacctcaagaacatccaaagtgtg
aatgtaaggtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggaagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata
ctgaacaaggggagcaccaactga

DBGET integrated database retrieval system