KEGG   Homo sapiens (human): 2921Help
Entry
2921              CDS       T01001                                 

Gene name
CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Definition
chemokine (C-X-C motif) ligand 3
Orthology
K05505  
C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
TNF signaling pathway
Salmonella infection
Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    2921 (CXCL3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2921 (CXCL3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2921 (CXCL3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    2921 (CXCL3)
   05134 Legionellosis
    2921 (CXCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 107 aa AA seqDB search
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgtccgtggtcactgaa
ctgcgctgccagtgcttgcagacactgcagggaattcacctcaagaacatccaaagtgtg
aatgtaaggtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggaagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata
ctgaacaaggggagcaccaactga

DBGET integrated database retrieval system