KEGG   Homo sapiens (human): 2925Help
Entry
2925              CDS       T01001                                 

Gene name
GRPR, BB2
Definition
gastrin-releasing peptide receptor
Orthology
K04169  
gastrin-releasing peptide receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2925 (GRPR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2925 (GRPR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Bombesin
    2925 (GRPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xp22.2
AA seq 384 aa AA seqDB search
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaatgactgtttccttctgaacttggaggtggaccatttcatgcactgcaac
atctccagtcacagtgcggatctccccgtgaacgatgactggtcccacccggggatcctc
tatgtcatccctgcagtttatggggttatcattctgataggcctcattggcaacatcact
ttgatcaagatcttctgtacagtcaagtccatgcgaaacgttccaaacctgttcatttcc
agtctggctttgggagacctgctcctcctaataacgtgtgctccagtggatgccagcagg
tacctggctgacagatggctatttggcaggattggctgcaaactgatcccctttatacag
cttacctctgttggggtgtctgtcttcacactcacggcgctctcggcagacagatacaaa
gccattgtccggccaatggatatccaggcctctcatgccctgatgaagatctgcctcaaa
gccgcctttatctggatcatctccatgctgctggccattccagaggccgtgttttctgac
ctccatcccttccatgaggaaagcaccaaccagaccttcattagctgtgccccataccca
cactctaatgagcttcaccccaaaatccattctatggcttcctttctggtcttctacgtc
attccactgtcgatcatctctgtttactactacttcattgctaaaaatctgatccagagt
gcttacaatcttcccgtggaagggaatatacatgtcaagaagcagattgaatcccggaag
cgacttgccaagacagtgctggtgtttgtgggcctgttcgccttctgctggctccccaat
catgtcatctacctgtaccgctcctaccactactctgaggtggacacctccatgctccac
tttgtcaccagcatctgtgcccgcctcctggccttcaccaactcctgcgtgaaccccttt
gccctctacctgctgagcaagagtttcaggaaacagttcaacactcagctgctctgttgc
cagcctggcctgatcatccggtctcacagcactggaaggagtacaacctgcatgacctcc
ctcaagagtaccaacccctccgtggccacctttagcctcatcaatggaaacatctgtcac
gagcggtatgtctag

DBGET integrated database retrieval system