KEGG   Homo sapiens (human): 293Help
Entry
293               CDS       T01001                                 

Gene name
SLC25A6, 2, 3, AAC3, ANT, ANT_2, ANT_3, ANT3, ANT3Y
Definition
solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6
Orthology
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Parkinson's disease
Huntington's disease
Influenza A
HTLV-I infection
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xp22.32 and Yp11.3
AA seq 298 aa AA seqDB search
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaggccatctccttcgccaaagacttcttggccggaggcatcgccgccgcc
atctccaagacggccgtggctccgatcgagcgggtcaagctgctgctgcaggtccagcac
gccagcaagcagatcgccgccgacaagcagtacaagggcatcgtggactgcattgtccgc
atccccaaggagcagggcgtgctgtccttctggaggggcaaccttgccaacgtcattcgc
tacttccccactcaagccctcaacttcgccttcaaggataagtacaagcagatcttcctg
gggggcgtggacaagcacacgcagttctggaggtactttgcgggcaacctggcctccggc
ggtgcggccggcgcgacctccctctgcttcgtgtacccgctggatttcgccagaacccgc
ctggcagcggacgtgggaaagtcaggcacagagcgcgagttccgaggcctgggagactgc
ctggtgaagatcaccaagtccgacggcatccggggcctgtaccagggcttcagtgtctcc
gtgcagggcatcatcatctaccgggcggcctacttcggcgtgtacgatacggccaagggc
atgctccccgaccccaagaacacgcacatcgtggtgagctggatgatcgcgcagaccgtg
acggccgtggccggcgtggtgtcctaccccttcgacacggtgcggcggcgcatgatgatg
cagtccgggcgcaaaggagctgacatcatgtacacgggcaccgtcgactgttggaggaag
atcttcagagatgaggggggcaaggccttcttcaagggtgcgtggtccaacgtcctgcgg
ggcatggggggcgccttcgtgctggtcctgtacgacgagctcaagaaggtgatctaa

DBGET integrated database retrieval system