KEGG   Homo sapiens (human): 293Help
Entry
293               CDS       T01001                                 

Gene name
SLC25A6, AAC3, ANT, ANT_2, ANT_3, ANT3, ANT3Y
Definition
(RefSeq) solute carrier family 25 member 6
  KO
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Necroptosis
Parkinson's disease
Huntington's disease
Influenza A
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    293 (SLC25A6)
   04022 cGMP - PKG signaling pathway
    293 (SLC25A6)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    293 (SLC25A6)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    293 (SLC25A6)
   05016 Huntington's disease
    293 (SLC25A6)
  Infectious diseases
   05166 HTLV-I infection
    293 (SLC25A6)
   05164 Influenza A
    293 (SLC25A6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    293 (SLC25A6)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   293 (SLC25A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P12236(Tbio)
UniProt: 
Position
Xp22.33 and Yp11.2
AA seq 298 aa AA seqDB search
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaggccatctccttcgccaaagacttcttggccggaggcatcgccgccgcc
atctccaagacggccgtggctccgatcgagcgggtcaagctgctgctgcaggtccagcac
gccagcaagcagatcgccgccgacaagcagtacaagggcatcgtggactgcattgtccgc
atccccaaggagcagggcgtgctgtccttctggaggggcaaccttgccaacgtcattcgc
tacttccccactcaagccctcaacttcgccttcaaggataagtacaagcagatcttcctg
gggggcgtggacaagcacacgcagttctggaggtactttgcgggcaacctggcctccggc
ggtgcggccggcgcgacctccctctgcttcgtgtacccgctggatttcgccagaacccgc
ctggcagcggacgtgggaaagtcaggcacagagcgcgagttccgaggcctgggagactgc
ctggtgaagatcaccaagtccgacggcatccggggcctgtaccagggcttcagtgtctcc
gtgcagggcatcatcatctaccgggcggcctacttcggcgtgtacgatacggccaagggc
atgctccccgaccccaagaacacgcacatcgtggtgagctggatgatcgcgcagaccgtg
acggccgtggccggcgtggtgtcctaccccttcgacacggtgcggcggcgcatgatgatg
cagtccgggcgcaaaggagctgacatcatgtacacgggcaccgtcgactgttggaggaag
atcttcagagatgaggggggcaaggccttcttcaagggtgcgtggtccaacgtcctgcgg
ggcatggggggcgccttcgtgctggtcctgtacgacgagctcaagaaggtgatctaa

DBGET integrated database retrieval system