KEGG   Homo sapiens (human): 2936Help
Entry
2936              CDS       T01001                                 

Gene name
GSR, HEL-75, HEL-S-122m
Definition
(RefSeq) glutathione reductase (EC:1.8.1.7)
  KO
K00383  
glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2936 (GSR)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    2936 (GSR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     2936 (GSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p21.1
AA seq 522 aa AA seqDB search
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctgccccgagccctgagcgccggcgcgggaccgagctggcggcgggcggcg
cgcgccttccgaggcttcctgctgcttctgcccgagcccgcggccctcacgcgcgccctc
tcccgtgccatggcctgcaggcaggagccgcagccgcagggcccgccgcccgctgctggc
gccgtggcctcctatgactacctggtgatcgggggcggctcgggcgggctggccagcgcg
cgcagggcggccgagctgggtgccagggccgccgtggtggagagccacaagctgggtggc
acttgcgtgaatgttggatgtgtacccaaaaaggtaatgtggaacacagctgtccactct
gaattcatgcatgatcatgctgattatggctttccaagttgtgagggtaaattcaattgg
cgtgttattaaggaaaagcgggatgcctatgtgagccgcctgaatgccatctatcaaaac
aatctcaccaagtcccatatagaaatcatccgtggccatgcagccttcacgagtgatccc
aagcccacaatagaggtcagtgggaaaaagtacaccgccccacacatcctgatcgccaca
ggtggtatgccctccacccctcatgagagccagatccccggtgccagcttaggaataacc
agcgatggattttttcagctggaagaattgcccggccgcagcgtcattgttggtgcaggt
tacattgctgtggagatggcagggatcctgtcagccctgggttctaagacatcactgatg
atacggcatgataaggtacttagaagttttgattcaatgatcagcaccaactgcacggag
gagctggagaacgctggcgtggaggtgctgaagttctcccaggtcaaggaggttaaaaag
actttgtcgggcttggaagtcagcatggttactgcagttcccggtaggctaccagtcatg
accatgattccagatgttgactgcctgctctgggccattgggcgggtcccgaataccaag
gacctgagtttaaacaaactggggattcaaaccgatgacaagggtcatatcatcgtagac
gaattccagaataccaacgtcaaaggcatctatgcagttggggatgtatgtggaaaagct
cttcttactccagttgcaatagctgctggccgaaaacttgcccatcgactttttgaatat
aaggaagattccaaattagattataacaacatcccaactgtggtcttcagccacccccct
attgggacagtgggactcacggaagatgaagccattcataaatatggaatagaaaatgtg
aagacctattcaacgagctttaccccgatgtatcacgcagttaccaaaaggaaaacaaaa
tgtgtgatgaaaatggtctgtgctaacaaggaagaaaaggtggttgggatccatatgcag
ggacttgggtgtgatgaaatgctgcagggttttgctgttgcagtgaagatgggagcaacg
aaggcagactttgacaacacagtcgccattcaccctacctcttcagaagagctggtcaca
cttcgttga

DBGET integrated database retrieval system