KEGG   Homo sapiens (human): 2938Help
Entry
2938              CDS       T01001                                 

Gene name
GSTA1, GST-epsilon, GST2, GSTA1-1, GTH1
Definition
(RefSeq) glutathione S-transferase alpha 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2938 (GSTA1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2938 (GSTA1)
   00982 Drug metabolism - cytochrome P450
    2938 (GSTA1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    2938 (GSTA1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2938 (GSTA1)
  Drug resistance
   01524 Platinum drug resistance
    2938 (GSTA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2938 (GSTA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P08263(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactacttcaatgcacggggcagaatggagtccacccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagagagccctgattgatatgtatatagaaggtatagca
gatttgggtgaaatgatcctccttctgcccgtatgtccacctgaggaaaaagatgccaag
cttgccttgatcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattcatctg
gtggaacttctctactacgtcgaggagcttgactccagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

DBGET integrated database retrieval system