KEGG   Homo sapiens (human): 2944Help
Entry
2944              CDS       T01001                                 

Gene name
GSTM1, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
Definition
(RefSeq) glutathione S-transferase mu 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Network
N00243  
KEAP1-NRF2 signaling pathway
N00244  
Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  
Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2944 (GSTM1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2944 (GSTM1)
   00982 Drug metabolism - cytochrome P450
    2944 (GSTM1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2944 (GSTM1)
   05204 Chemical carcinogenesis
    2944 (GSTM1)
   05225 Hepatocellular carcinoma
    2944 (GSTM1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2944 (GSTM1)
  Drug resistance
   01524 Platinum drug resistance
    2944 (GSTM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2944 (GSTM1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2944 (GSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P09488(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctatgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcttgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccagaccatggacaaccatatgcagctgggcatgatctgctacaatccagaattt
gagaaactgaagccaaagtacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggaaacaagatcacttttgtagattttctcgtc
tatgatgtccttgacctccaccgtatatttgagcccaagtgcttggacgccttcccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttctcaaagatggctgtctggggcaacaagtag

DBGET integrated database retrieval system