KEGG   Homo sapiens (human): 2944Help
Entry
2944              CDS       T01001                                 

Gene name
GSTM1, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
Definition
glutathione S-transferase mu 1 (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2944 (GSTM1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2944 (GSTM1)
   00982 Drug metabolism - cytochrome P450
    2944 (GSTM1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    2944 (GSTM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2944 (GSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctatgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcttgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccagaccatggacaaccatatgcagctgggcatgatctgctacaatccagaattt
gagaaactgaagccaaagtacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggaaacaagatcacttttgtagattttctcgtc
tatgatgtccttgacctccaccgtatatttgagcccaagtgcttggacgccttcccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttctcaaagatggctgtctggggcaacaagtag

DBGET integrated database retrieval system