KEGG   Homo sapiens (human): 2947Help
Entry
2947              CDS       T01001                                 

Gene name
GSTM3, GST5, GSTB, GSTM3-3, GTM3
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2947 (GSTM3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2947 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    2947 (GSTM3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    2947 (GSTM3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2947 (GSTM3)
  Drug resistance
   01524 Platinum drug resistance
    2947 (GSTM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2947 (GSTM3)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2947 (GSTM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P21266(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 225 aa AA seqDB search
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgagtcgtctatggttctcgggtactgggatattcgtgggctggcgcacgcc
atccgcctgctcctggagttcacggatacctcttatgaggagaaacggtacacgtgcggg
gaagctcctgactatgatcgaagccaatggctggatgtgaaattcaagctagacctggac
tttcctaatctgccctacctcctggatgggaagaacaagatcacccagagcaatgccatc
ttgcgctacatcgctcgcaagcacaacatgtgtggtgagactgaagaagaaaagattcga
gtggacatcatagagaaccaagtaatggatttccgcacacaactgataaggctctgttac
agctctgaccacgaaaaactgaagcctcagtacttggaagagctacctggacaactgaaa
caattctccatgtttctggggaaattctcatggtttgccggggaaaagctcacctttgtg
gattttctcacctatgatatcttggatcagaaccgtatatttgaccccaagtgcctggat
gagttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaaaatcgctgcc
tacttacagtctgatcagttctgcaagatgcccatcaacaacaagatggcccagtggggc
aacaagcctgtatgctga

DBGET integrated database retrieval system