KEGG   Homo sapiens (human): 2950Help
Entry
2950              CDS       T01001                                 

Gene name
GSTP1, DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
Definition
(RefSeq) glutathione S-transferase pi 1 (EC:2.5.1.18)
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Prostate cancer
Disease
H00024  
Prostate cancer
Drug target
Ezatiostat hydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2950 (GSTP1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2950 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    2950 (GSTP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2950 (GSTP1)
   05204 Chemical carcinogenesis
    2950 (GSTP1)
   05215 Prostate cancer
    2950 (GSTP1)
  Drug resistance
   01524 Platinum drug resistance
    2950 (GSTP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2950 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 210 aa AA seqDB search
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacatctccctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat
gtggggcgcctcagtgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system