KEGG   Homo sapiens (human): 2950Help
Entry
2950              CDS       T01001                                 

Gene name
GSTP1, DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
Definition
(RefSeq) glutathione S-transferase pi 1 (EC:2.5.1.18)
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Pathways in cancer
Chemical carcinogenesis
Prostate cancer
Disease
H00024  
Prostate cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2950 (GSTP1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2950 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    2950 (GSTP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2950 (GSTP1)
   05204 Chemical carcinogenesis
    2950 (GSTP1)
   05215 Prostate cancer
    2950 (GSTP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2950 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 210 aa AA seqDB search
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacatctccctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat
gtggggcgcctcagtgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system