KEGG   Homo sapiens (human): 2952Help
Entry
2952              CDS       T01001                                 

Gene name
GSTT1
Definition
(RefSeq) glutathione S-transferase theta 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Disease
H00516  
Isolated orofacial clefts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2952 (GSTT1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2952 (GSTT1)
   00982 Drug metabolism - cytochrome P450
    2952 (GSTT1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    2952 (GSTT1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2952 (GSTT1)
  Drug resistance
   01524 Platinum drug resistance
    2952 (GSTT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2952 (GSTT1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2952 (GSTT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Pharos: 
P30711(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 240 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacctggacctgctgtcccagccctgccgcgctgtttacatcttt
gccaagaagaacgacattcccttcgagctgcgcatcgtggatctgattaaaggtcagcac
ttaagcgatgcctttgcccaggtgaaccccctcaagaaggtgccagccttgaaggacggg
gacttcaccttgacggagagtgtggccatcctgctctacctgacgcgcaaatataaggtc
cctgactactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca
tggcagcacacgactctgcggagaagctgcctccgggccttgtggcataaggtgatgttc
cctgttttcctgggtgagccagtatctccccagacactggcagccaccctggcagagttg
gatgtgaccctgcagttgctcgaggacaagttcctccagaacaaggccttccttactggt
cctcacatctccttagctgacctcgtagccatcacggagctgatgcatcccgtgggtgct
ggctgccaagtcttcgaaggccgacccaagctggccacatggcggcagcgcgtggaggca
gcagtgggggaggacctcttccaggaggcccatgaggtcattctgaaggccaaggacttc
ccacctgcagaccccaccataaagcagaagctgatgccctgggtgctggccatgatccgg
tga

DBGET integrated database retrieval system