KEGG   Homo sapiens (human): 2954Help
Entry
2954              CDS       T01001                                 

Gene name
GSTZ1, GSTZ1-1, MAAI, MAI
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  
maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    2954 (GSTZ1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     2954 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O43708(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 216 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
TLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggggaagcccatcctctattcctatttccgaagctcctgctcatggagagtt
cgaattgctctggccttgaaaggcatcgactacgagacggtgcccatcaatctcataaag
gatgggggccaacagttttctaaggacttccaggcactgaatcctatgaagcaggtgcca
accctgaagattgatggaatcaccattcaccagtcactggccatcattgagtatctagag
gagatgcgtcccactccgcgacttctgcctcaggacccaaagaagagggccagcgtgcgt
atgatttctgacctcatcgctggtggcatccagcccctgcagaacctgtctgtcctgaag
caagtgggagaggagatgcagctgacctgggcccagaacgccatcacttgtggctttaac
gccctggagcagatcctacagagcacagcgggcatatactgtgtaggagacgaggtgacc
atggctgatctgtgcttggtgcctcaggtggcaaatgctgaaagattcaaggtggatctc
accccctaccctaccatcagctccatcaacaagaggctgctggtcttggaggccttccag
gtgtctcacccctgccggcagccagatacacccactgagctgagggcctag

DBGET integrated database retrieval system