KEGG   Homo sapiens (human): 2957Help
Entry
2957              CDS       T01001                                 

Gene name
GTF2A1, TF2A1, TFIIA, TFIIA-42, TFIIAL
Definition
general transcription factor IIA, 1, 19/37kDa
Orthology
K03122  
transcription initiation factor TFIIA large subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2957 (GTF2A1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2957 (GTF2A1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     2957 (GTF2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q31.1
AA seq 326 aa AA seqDB search
MQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPAS
QQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAAN
GAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTG
NKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEED
YDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWK
FHLKDGIMNLNGRDYIFSKAIGDAEW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccagggcagtagatggatttcattcagaagagcagcagcttctactgcaagtt
caacagcagcatcaaccccagcagcagcagcatcaccaccatcaccatcatcagcaagct
cagcctcagcagacagtacctcagcaagcgcagacccagcaggttcttattcctgcatca
cagcaagccacagcaccacaagttattgttccagattctaagttgatacagcatatgaat
gcatcaaacatgagtgctgctgctacagctgctaccttagcactccctgcaggtgtgact
cctgttcagcagatattaacaaattcaggccagcttcttcaggtggtcagagcagccaat
ggtgcccaatatatctttcagcctcagcagtcagtggttctacaacaacaggttatacca
caaatgcagcctggtggagtacaagctcctgttatacagcaggtgctggctcctcttcct
ggagggatttcaccacagacaggtgtcatcatccagcctcagcaaatcttatttacagga
aataagactcaagttatacctacgacagtggcagcacctacaccagcccaagcacagata
actgcaactggccagcagcaaccgcaggcccagcctgctcaaacacaagctccattggtc
ttacaagttgatggaactggggatacatcatctgaagaagatgaagatgaagaagaagac
tatgatgatgatgaggaggaagacaaagagaaagatggagctgaagatgggcaggtggaa
gaagagcccctcaatagtgaagatgatgtgagtgatgaggaaggacaggaactctttgac
acagaaaatgttgttgtatgccaatatgataagatacacagaagtaaaaacaaatggaaa
tttcatctcaaggatggcattatgaatcttaatggaagagattatatattttccaaagcc
attggagatgcagaatggtga

DBGET integrated database retrieval system