KEGG   Homo sapiens (human): 2958Help
Entry
2958              CDS       T01001                                 

Gene name
GTF2A2, HsT18745, T18745, TF2A2, TFIIA, TFIIA-12, TFIIA-gamma, TFIIAS
Definition
(RefSeq) general transcription factor IIA subunit 2
  KO
K03123  
transcription initiation factor TFIIA small subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2958 (GTF2A2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2958 (GTF2A2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     2958 (GTF2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.2
AA seq 109 aa AA seqDB search
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagttatacagaaatactactttgggaaacagtcttcaggagagcctagat
gagctcatacagtctcaacagatcaccccccaacttgcccttcaagttctacttcagttt
gataaggctataaatgcagcactggctcagagggtcaggaacagagtcaatttcaggggc
tctctaaatacgtacagattctgcgataatgtgtggacttttgtactgaatgatgttgaa
ttcagagaggtgacagaacttattaaagtggataaagtgaaaattgtagcctgtgatggt
aaaaatactggctccaatactacagaatga

DBGET integrated database retrieval system