KEGG   Homo sapiens (human): 2958Help
Entry
2958              CDS       T01001                                 

Gene name
GTF2A2, HsT18745, TF2A2, TFIIA
Definition
general transcription factor IIA, 2, 12kDa
Orthology
K03123  
transcription initiation factor TFIIA small subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2958 (GTF2A2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2958 (GTF2A2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     2958 (GTF2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.2
AA seq 109 aa AA seqDB search
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagttatacagaaatactactttgggaaacagtcttcaggagagcctagat
gagctcatacagtctcaacagatcaccccccaacttgcccttcaagttctacttcagttt
gataaggctataaatgcagcactggctcagagggtcaggaacagagtcaatttcaggggc
tctctaaatacgtacagattctgcgataatgtgtggacttttgtactgaatgatgttgaa
ttcagagaggtgacagaacttattaaagtggataaagtgaaaattgtagcctgtgatggt
aaaaatactggctccaatactacagaatga

DBGET integrated database retrieval system