KEGG   Homo sapiens (human): 2958Help
Entry
2958              CDS       T01001                                 

Gene name
GTF2A2, HsT18745, TF2A2, TFIIA
Definition
general transcription factor IIA, 2, 12kDa
Orthology
K03123  
transcription initiation factor TFIIA small subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Viral carcinogenesis
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.2
AA seq 109 aa AA seqDB search
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagttatacagaaatactactttgggaaacagtcttcaggagagcctagat
gagctcatacagtctcaacagatcaccccccaacttgcccttcaagttctacttcagttt
gataaggctataaatgcagcactggctcagagggtcaggaacagagtcaatttcaggggc
tctctaaatacgtacagattctgcgataatgtgtggacttttgtactgaatgatgttgaa
ttcagagaggtgacagaacttattaaagtggataaagtgaaaattgtagcctgtgatggt
aaaaatactggctccaatactacagaatga

DBGET integrated database retrieval system