KEGG   Homo sapiens (human): 2959Help
Entry
2959              CDS       T01001                                 

Gene name
GTF2B, TF2B, TFIIB
Definition
general transcription factor IIB
Orthology
K03124  
transcription initiation factor TFIIB
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Epstein-Barr virus infection
Viral carcinogenesis
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p22-p21
AA seq 316 aa AA seqDB search
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctaccagccgtttggatgctcttccaagagtcacatgtccaaaccatccagat
gcgattttagtggaggactacagagccggtgatatgatctgtcctgaatgtggcttggtt
gtaggtgaccgggttattgatgtgggatctgaatggcgaactttcagcaatgacaaagca
acaaaagatccatctcgagttggagattctcagaatcctcttctgagtgatggagatttg
tctaccatgattggcaagggcacaggagctgcaagttttgacgaatttggcaattctaag
taccagaatcggagaacaatgagcagttctgatcgggcaatgatgaatgcattcaaagaa
atcactaccatggcagacagaatcaatctacctcgaaatatagttgatcgaacaaataat
ttattcaagcaagtatatgaacagaagagcctgaagggaagagctaatgatgctatagct
tctgcttgtctctatattgcctgtagacaagaaggggttcctaggacatttaaagaaata
tgtgccgtatcacgaatttctaagaaagaaattggtcggtgttttaaacttattttgaaa
gcgctagaaaccagtgtggatttgattacaactggggacttcatgtccaggttctgttcc
aacctttgtcttcctaaacaagtacagatggcagctacacatatagcccgtaaagctgtg
gaattggacttggttcctgggaggagccccatctctgtggcagcggcagctatttacatg
gcctcacaggcatcagctgaaaagaggacccaaaaagaaattggagatattgctggtgtt
gctgatgttacaatcagacagtcctatagactgatctatcctcgagccccagatctgttt
cctacagacttcaaatttgacaccccagtggacaaactaccacagctataa

DBGET integrated database retrieval system