KEGG   Homo sapiens (human): 2960Help
Entry
2960              CDS       T01001                                 

Gene name
GTF2E1, FE, TF2E1, TFIIE-A
Definition
(RefSeq) general transcription factor IIE subunit 1
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00225  EBV EBNA2 binding to host-cell-protein
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2960 (GTF2E1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2960 (GTF2E1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    2960 (GTF2E1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     2960 (GTF2E1)
 Prokaryotic type
  Archaeal type
    TFE
     2960 (GTF2E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIE_alpha TFIIE-A_C TF_Zn_Ribbon OrfB_Zn_ribbon DUF1980 Rad50_zn_hook Elf1 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 2960
NCBI-ProteinID: NP_005504
OMIM: 189962
HGNC: 4650
Ensembl: ENSG00000153767
Vega: OTTHUMG00000159667
Pharos: P29083(Tbio)
UniProt: P29083
Structure
PDB: 

Jmol
Position
3q13.33
AA seq 439 aa AA seqDB search
MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERD
STNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGI
DMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSE
SDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP
EEKEAYIAMGQRMFEDLFE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccagatgtcctcactgaagttccagcagcattgaagcggttagccaagtat
gtgatccggggattttatggcattgagcatgccttggccttggacatcttgatcaggaac
tcctgtgtgaaagaggaggatatgctggagctgctcaagtttgatcggaagcaacttcga
tcagttttgaataatttaaagggagacaagtttatcaaatgcagaatgagggtagagact
gctgcagacgggaaaaccactcgccataactactacttcatcaattatcgtactcttgtt
aatgtggtaaaatataaactggaccacatgagaagaagaattgagaccgatgagagagat
tcgaccaaccgggcttccttcaaatgtcctgtctgtagtagtactttcacagacttagaa
gctaatcagctctttgatcctatgacaggaactttccgctgtactttttgccatacagag
gtagaagaggatgaatcagcaatgcccaaaaaagatgcacgcacacttttggcaaggttt
aatgaacaaattgagcccatttatgcattgcttcgggagacagaggatgtgaacttggcc
tatgaaatacttgagccagaacccacagaaatcccagccctgaaacagagcaaggaccat
gcagcaactactgctggagctgctagcctagcaggtgggcaccaccgggaagcatgggcc
accaaaggtccttcctatgaagacttatacactcagaatgttgtcattaacatggatgac
caagaagatcttcatcgagcctcactggaagggaaatctgccaaagagaggcctatttgg
ttgagagaaagcactgtccaaggggcatatggttctgaagatatgaaagaagggggcata
gatatggacgcatttcaggagcgtgaggaaggccatgctgggcctgatgacaacgaagag
gtcatgcgagcactgctcattcacgagaaaaagacttcctctgccatggctggttcagtg
ggggcagctgctccagtgaccgctgccaatggcagtgactcagaaagcgagaccagtgag
tcagatgatgattctccaccccgtccggcagctgtggctgtgcataaacgagaagaggat
gaagaggaagatgacgagtttgaagaagtagcagatgaccccattgtcatggtggctggc
cgtccgttctcctacagtgaagtgagccaacggccagagctagtggcccagatgacacca
gaagaaaaggaagcatatatagcaatgggacaacgcatgtttgaggacctctttgagtga

DBGET integrated database retrieval system