KEGG   Homo sapiens (human): 2961Help
Entry
2961              CDS       T01001                                 

Gene name
GTF2E2, FE, TF2E2, TFIIE-B
Definition
general transcription factor IIE, polypeptide 2, beta 34kDa
Orthology
K03137  
transcription initiation factor TFIIE subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2961 (GTF2E2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2961 (GTF2E2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    2961 (GTF2E2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     2961 (GTF2E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 291 aa AA seqDB search
MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNG
SFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLM
TEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQK
AVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatccaagcctgttgagagaaagggagctgttcaaaaaacgagctctttctactcct
gtagtagaaaaacgttcagcatcttctgagtcatcatcatcatcgtcaaagaagaagaaa
acaaaggtagaacatggaggatcgtcaggctctaaacaaaattctgatcatagcaatgga
tcatttaacttgaaagctttgtcaggaagctctggatataagtttggtgttcttgctaag
attgtgaattacatgaagacacggcatcagcgaggagatacgcatcctctaaccttagat
gaaattttggatgaaacacaacatttagatattggactcaagcagaaacaatggctaatg
actgaggctttagtcaacaatcccaaaattgaagtaatagatgggaagtatgctttcaag
cccaagtacaacgtgagagataagaaggccctacttaggctcttagatcagcatgaccag
cgaggattaggaggaattcttttagaagacatagaagaagcactgcccaattcccagaaa
gctgtcaaggctttgggggaccagatactatttgtaaatcgtcccgataagaagaaaata
cttttcttcaatgataagagctgtcagttttctgtggatgaagaatttcagaaactgtgg
aggagtgtcactgtagattccatggacgaggagaaaattgaagaatatctgaagcgacag
ggtatttcttccatgcaggaatctggaccaaagaaagtggcccctattcagagaaggaaa
aagcctgcttcacagaaaaagcgacgctttaagactcataacgaacacttggctggagtg
ctgaaggattactctgacattacttccagcaaatag

DBGET integrated database retrieval system