KEGG   Homo sapiens (human): 2961Help
Entry
2961              CDS       T01001                                 

Gene name
GTF2E2, FE, TF2E2, TFIIE-B, TTD6
Definition
(RefSeq) general transcription factor IIE subunit 2
  KO
K03137  transcription initiation factor TFIIE subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00225  EBV EBNA2 binding to host-cell-protein
Disease
H00866  Trichothiodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2961 (GTF2E2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2961 (GTF2E2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    2961 (GTF2E2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     2961 (GTF2E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIE_beta
Motif
Other DBs
NCBI-GeneID: 2961
NCBI-ProteinID: NP_002086
OMIM: 189964
HGNC: 4651
Ensembl: ENSG00000197265
Vega: OTTHUMG00000163934
Pharos: P29084(Tbio)
UniProt: P29084
Structure
PDB: 

Jmol
Position
8p12
AA seq 291 aa AA seqDB search
MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNG
SFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLM
TEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQK
AVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatccaagcctgttgagagaaagggagctgttcaaaaaacgagctctttctactcct
gtagtagaaaaacgttcagcatcttctgagtcatcatcatcatcgtcaaagaagaagaaa
acaaaggtagaacatggaggatcgtcaggctctaaacaaaattctgatcatagcaatgga
tcatttaacttgaaagctttgtcaggaagctctggatataagtttggtgttcttgctaag
attgtgaattacatgaagacacggcatcagcgaggagatacgcatcctctaaccttagat
gaaattttggatgaaacacaacatttagatattggactcaagcagaaacaatggctaatg
actgaggctttagtcaacaatcccaaaattgaagtaatagatgggaagtatgctttcaag
cccaagtacaacgtgagagataagaaggccctacttaggctcttagatcagcatgaccag
cgaggattaggaggaattcttttagaagacatagaagaagcactgcccaattcccagaaa
gctgtcaaggctttgggggaccagatactatttgtaaatcgtcccgataagaagaaaata
cttttcttcaatgataagagctgtcagttttctgtggatgaagaatttcagaaactgtgg
aggagtgtcactgtagattccatggacgaggagaaaattgaagaatatctgaagcgacag
ggtatttcttccatgcaggaatctggaccaaagaaagtggcccctattcagagaaggaaa
aagcctgcttcacagaaaaagcgacgctttaagactcataacgaacacttggctggagtg
ctgaaggattactctgacattacttccagcaaatag

DBGET integrated database retrieval system