KEGG   Homo sapiens (human): 2965Help
Entry
2965              CDS       T01001                                 

Gene name
GTF2H1, BTF2, P62, TFB1, TFIIH
Definition
general transcription factor IIH, polypeptide 1, 62kDa
Orthology
K03141  
transcription initiation factor TFIIH subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.1-p14
AA seq 548 aa AA seqDB search
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLMKKT
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctcatctgaagaagttttgctgattgtaaagaaagtgcgtcaaaagaagcag
gatggagctctgtacctcatggcagaaagaattgcttgggcacctgaaggcaaagataga
tttacaatcagccatatgtatgcagatattaaatgccagaaaattagtccagaaggaaaa
gctaaaattcagcttcagctggtcctacatgcaggggacacaactaacttccatttttcc
aatgaaagcacagcagtgaaagagcgagatgcagtaaaagaccttcttcagcagctgctg
cccaaattcaagaggaaagcaaataaagaactggaagagaagaacagaatgctgcaagaa
gatcctgttttgtttcagctttataaagaccttgttgtgagtcaagtgatcagtgctgag
gaattctgggccaatcgtttaaatgtgaatgcaacagatagttcttccacatccaatcat
aagcaggatgttggcatttctgctgcatttctggctgatgtccggccccaaactgatggc
tgtaacggtctaagatataatttaacttctgatatcattgagtccatatttaggacctat
ccagcagtaaaaatgaaatatgcagaaaatgttccccacaacatgacagagaaggaattc
tggacacgttttttccagtcccattattttcacagggatcggctgaatacagggtcaaag
gatctctttgcagaatgtgccaaaatagatgaaaaaggcctaaaaacaatggtttcatta
ggagtgaaaaacccactactagatttaacagctttggaagataaaccattagatgagggc
tatggcatttcctctgtgccatctgcttccaattctaaatccataaaagagaatagtaat
gctgccatcatcaagagatttaaccatcacagtgccatggtcctggcagctggactcaga
aaacaagaagcacaaaatgaacaaactagtgagcccagcaacatggatggaaattccgga
gatgcagactgctttcagccagcagtcaaaagggcgaaattacaagagtccattgaatat
gaagacttggggaaaaataattctgtaaaaacgattgcactaaacctcaagaagtcagat
aggtattatcatggtccaactccaatccagtcactacagtatgcaacaagtcaggacatt
attaattcttttcaaagtattagacaagaaatggaagcttatacacccaagttaactcag
gttctctcaagtagtgctgccagtagtaccatcacagcactgtcacctggaggggcactt
atgcagggaggaacacagcaagccataaaccagatggtgccaaatgatattcaatctgaa
ttgaaacacttatatgtagctgttggagaacttctacgacatttctggtcctgctttcct
gttaatacgccattcctagaagaaaaggtagtgaaaatgaaaagtaatttggaacgattc
caagttacgaagctctgtccattccaagaaaagattcggagacagtatttaagcacaaat
ttggtaagtcacatagaagagatgctccagacagcctacaacaagctccacacatggcag
tcacggcgtctgatgaagaaaacgtga

DBGET integrated database retrieval system