KEGG   Homo sapiens (human): 2966Help
Entry
2966              CDS       T01001                                 

Gene name
GTF2H2, BTF2, BTF2P44, T-BTF2P44, TFIIH, p44
Definition
general transcription factor IIH, polypeptide 2, 44kDa
Orthology
K03142  
transcription initiation factor TFIIH subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.2
AA seq 395 aa AA seqDB search
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacctgaaagaactaagcgatgggaaggaggctatgaaagaacatgggag
attcttaaagaagatgaatctggatcacttaaagctacaatagaagacattctattcaag
gcaaagagaaaaagagtatttgagcaccatggacaagttcgacttggaatgatgcgccac
ctttatgtggtagtagatggatcaagaacaatggaagaccaagatttaaagcctaataga
ctgacgtgtactttaaagttgttggaatactttgtagaggaatattttgatcaaaatcct
attagtcagattggaataattgtaactaagagtaaaagagctgaaaaattgactgaactt
tcaggaaacccaagaaaacatataacgtctttgaagaaagctgtggatatgacctgccat
ggagagccatctctttataattccctaagcatagctatgcagactctaaaacacatgcct
ggacatacaagtcgagaagtactaatcatctttagcagccttacaacttgcgatccatct
aatatttatgatctaatcaagaccctaaaggcagctaaaattagagtatctgttattgga
ttgtctgcagaagttcgcgtttgcactgtacttgctcgtgaaactggtggcacgtaccat
gttattttagatgaaagccattacaaagagttgctcacacatcatgttagtcctcctcct
gctagctcaagttctgaatgctcacttattcgtatgggatttcctcagcacaccattgct
tctttatctgaccaggatgcaaaaccctctttcagcatggcgcatttggatggcaatact
gagccagggcttacattaggaggctatttctgcccacagtgtcgggcaaagtactgtgag
ctacctgttgagtgtaaaatctgtggtcttactttggtgtctgctccccacttggcacgg
tcttaccatcatttgtttcctttggatgcttttcaagaaattcccctagaagaatataat
ggagaaagattttgttatggatgtcagggggaattgaaagaccaacatgtttatgtttgt
gctgtgtgccaaaatgttttctgtgtggactgtgatgtttttgttcatgattctctacac
tgttgccctggctgtattcataagattccagctccttcaggtgtttga

DBGET integrated database retrieval system