KEGG   Homo sapiens (human): 2967Help
Entry
2967              CDS       T01001                                 

Gene name
GTF2H3, BTF2, P34, TFB4, TFIIH
Definition
general transcription factor IIH, polypeptide 3, 34kDa
Orthology
K03143  
transcription initiation factor TFIIH subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2967 (GTF2H3)
  Replication and repair
   03420 Nucleotide excision repair
    2967 (GTF2H3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2967 (GTF2H3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2967 (GTF2H3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 265 aa AA seqDB search
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVI
ASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMT
KSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILACDITGGLYLKVPQMPSL
LQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICT
TCETAFKISLPPVLKAKKKKLKVSA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagacgaagatgaattgaatcttctggttattgtagttgatgccaacccaatt
tggtggggaaagcaagcattaaaggaatctcagttcactttatccaaatgcatagatgcc
gtgatggtgctgggaaattcgcatttattcatgaatcgttccaacaaacttgctgtgata
gcaagtcacattcaagaaagccgattcttatatcctggaaagaatggcagacttggagac
ttcttcggagaccctggcaaccctcctgaatttaatccctctgggagtaaagatggaaaa
tacgaacttttaacctcagcaaatgaagttattgttgaagagattaaagatctaatgacc
aaaagtgacataaagggtcaacatacagaaactttgctggcaggatccctggccaaagcc
ctttgctacattcatagaatgaacaaggaagttaaagacaatcaggaaatgaaatcaagg
atattggcttgtgacatcacgggaggactgtacctgaaggtgcctcagatgccttctctt
ctgcagtatttgctgtgggtgtttcttcccgatcaagatcagagatctcagttaatcctc
ccacccccagttcatgttgactacagggctgcttgcttctgtcatcgaaatctcattgaa
attggttatgtctgttctgtgtgtttgtcaatattctgcaatttcagccccatttgtact
acgtgcgagacagcctttaaaatttctctgcctccagtgctgaaagccaagaaaaagaaa
ctgaaagtgtctgcctga

DBGET integrated database retrieval system