KEGG   Homo sapiens (human): 29777Help
Entry
29777             CDS       T01001                                 

Gene name
ABT1, hABT1
Definition
(RefSeq) activator of basal transcription 1
  KO
K14785  
ESF2/ABP1 family protein
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    29777 (ABT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
6p22.2
AA seq 272 aa AA seqDB search
MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPL
HVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKR
VAASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKR
ETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRARKAARPGGRERARLATAQ
DKARSNKGLLARIFGAPPPSESMEGPSLVRDS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaggaatcggagaaggccgcaacggagcaagagccgctggaagggacagaa
cagacactagatgcggaggaggagcaggaggaatccgaagaagcggcctgtggcagcaag
aaacgggtagtgccaggtattgtgtacctgggccatatcccgccgcgcttccggcccctg
cacgtccgcaaccttctcagcgcctatggcgaggtcggacgcgtcttctttcaggctgag
gaccggttcgtgagacgcaagaagaaggcagcagcagctgccggaggaaaaaagcggtcc
tacaccaaggactacaccgagggatgggtggagttccgtgacaagcgcatagccaagcgc
gtggcggccagtctacacaacacgcctatgggtgcccgcaggcgcagccccttccgttat
gatctttggaacctcaagtacttgcaccgtttcacctggtcccacctcagcgagcacctc
gcctttgagcgccaggtgcgcaggcagcgcttgagagcggaggttgctcaagccaagcgt
gagaccgacttctatcttcaaagtgtggaacggggacaacgctttcttgcggccgatggg
gaccctgctcgcccagatggctcctggacatttgcccagcgtcctactgagcaggaactg
agggcccgtaaagcagcacggccagggggacgtgaacgggctcgcctggcaactgcccag
gacaaggcccgctccaacaaagggctcctggccaggatctttggagccccgccaccctca
gagagcatggagggaccttcccttgtcagggactcctga

DBGET integrated database retrieval system