KEGG   Homo sapiens (human): 2978Help
Entry
2978              CDS       T01001                                 

Gene name
GUCA1A, C6orf131, COD3, CORD14, GCAP, GCAP1, GUCA, GUCA1, dJ139D8.6
Definition
guanylate cyclase activator 1A (retina)
Orthology
K08328  
guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Phototransduction
Disease
H00481  
Cone-rod dystrophy and cone dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    2978 (GUCA1A)
   04740 Olfactory transduction
    2978 (GUCA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 201 aa AA seqDB search
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR
AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGADEAAEAAG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtgatggagggaaagtcagtggaggagctgagcagcaccgagtgccaccag
tggtacaagaagttcatgactgagtgcccctctggccaactcaccctctatgagttccgc
cagttcttcggcctcaagaacctgagcccgtcggccagccagtacgtggaacagatgttt
gagacttttgacttcaacaaggacggctacattgatttcatggagtacgtggcagcgctc
agcttggtcctcaaggggaaggtggaacagaagctccgctggtacttcaagctctatgat
gtagatggcaacggctgcattgaccgcgatgagctgctcaccatcatccaggccattcgc
gccattaacccctgcagcgataccaccatgactgcagaggagttcaccgatacagtgttc
tccaagattgacgtcaacggggatggggaactctccctggaagagtttatagagggcgtc
cagaaggaccagatgctcctggacacactgacacgaagcctggaccttacccgcatcgtg
cgcaggctccagaatggcgagcaagacgaggagggggctgacgaggccgctgaggcagcc
ggctga

DBGET integrated database retrieval system