KEGG   Homo sapiens (human): 29780Help
Entry
29780             CDS       T01001                                 

Gene name
PARVB, CGI-56
Definition
parvin, beta
Orthology
K06275  
parvin
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    29780 (PARVB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29780 (PARVB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2-q13.33
AA seq 397 aa AA seqDB search
MHHVFKDHQRGEKRGFLSPENKNCRRLELRRGCSCSWGLCSQALMASLAGSLLPGSDRSG
VETSEYAQGGVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFK
ELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQ
KLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQV
VVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKH
LNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELML
DGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatgtgtttaaagatcaccaaagaggagagaaaaggggattccttagtccagag
aacaaaaactgcaggaggctggagctgagacgtgggtgttcctgcagctggggcctgtgc
tcccaggcactcatggcttctctggctggttcacttctccctggctcagacagatcagga
gtggaaacatctgaatatgctcaaggaggagtgagtgacctgcaggaagaaggcaagaat
gccatcaactcaccgatgtcccccgccctggtggatgttcaccctgaagacacccagctt
gaggagaacgaggagcgcacgatgattgaccccacttccaaggaagaccccaagttcaag
gaactggtcaaggtcctcctcgactggattaatgacgtgctggtggaggagaggatcatt
gtgaagcagctggaggaagacctgtatgacggccaggtgctgcagaagctcttggaaaaa
ctggcagggtgcaagctgaatgtggctgaggtgacacagtccgaaatagggcagaaacag
aagctgcagacggtgctggaagcagtacatgacctgctgcggccccgaggctgggcgctc
cggtggagcgtggactcaattcacgggaagaacctggtggccatcctccacctgctggtc
tctctggccatgcacttcagggcccccatccgccttcctgagcatgtaacggtgcaggtg
gtggtcgtgcggaaacgggaaggcctgctgcattccagccacatctcggaggagctgacc
acaactacagagatgatgatgggccggttcgagcgggatgccttcgacacgctgttcgac
cacgccccggataagctcagcgtggtgaagaagtctctcatcacttttgtgaacaagcac
ctgaacaagctgaatttggaggtgacggaactggagacccagtttgcagatggcgtgtac
ctggttctgctcatgggccttctggaagactactttgttcctctccaccacttctacctg
actccggaaagcttcgatcagaaggtccacaatgtgtccttcgcctttgagctgatgctg
gacggaggcctcaagaaacccaaggctcgtcctgaagacgtggttaacttggacctcaaa
tccaccctgagggttctttacaacctgttcaccaagtacaagaacgtggagtga

DBGET integrated database retrieval system