KEGG   Homo sapiens (human): 29785Help
Entry
29785             CDS       T01001                                 

Gene name
CYP2S1
Definition
cytochrome P450, family 2, subfamily S, polypeptide 1 (EC:1.14.14.1)
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    29785 (CYP2S1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    29785 (CYP2S1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     29785 (CYP2S1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   29785 (CYP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 504 aa AA seqDB search
MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRL
SKKYGPVFTIYLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSN
GERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSN
VVCSLLFGLRFSYEDKEFQAVVRAAGGTLLGVSSQGGQTYEMFSWFLRPLPGPHKQLLHH
VSTLAAFTVRQVQQHQGNLDASGPARDLVDAFLLKMAQEEQNPGTEFTNKNMLMTVIYLL
FAGTMTVSTTVGYTLLLLMKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEA
QRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDA
DGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSLESPCPPDTLSLKPTVSG
LFNIPPAFQLQVRPTDLHSTTQTR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaccggcacctgggcgctgctgctggcgctggcgctgctcctgctgctgacg
ctggcgctgtccgggaccagggcccgaggccacctgccccccgggcccacgccgctacca
ctgctgggaaacctcctgcagctacggcccggggcgctgtattcagggctcatgcggctg
agtaagaagtacggaccggtgttcaccatctacctgggaccgtggcggcctgtggtggtc
ctggttgggcaggaggctgtgcgggaggccctgggaggtcaggctgaggagttcagcggc
cggggaaccgtagcgatgctggaagggacttttgatggccatggggttttcttctccaac
ggggagcggtggaggcagctgaggaagtttaccatgcttgctctgcgggacctgggcatg
gggaagcgagaaggcgaggagctgatccaggcggaggcccggtgtctggtggagacattc
caggggacagaaggacgcccattcgatccctccctgctgctggcccaggccacctccaac
gtagtctgctccctcctctttggcctccgcttctcctatgaggataaggagttccaggcc
gtggtccgggcagctggtggtaccctgctgggagtcagctcccaggggggtcagacctac
gagatgttctcctggttcctgcggcccctgccaggcccccacaagcagctcctccaccac
gtcagcaccttggctgccttcacagtccggcaggtgcagcagcaccaggggaacctggat
gcttcgggccccgcacgtgaccttgtcgatgccttcctgctgaagatggcacaggaggaa
caaaacccaggcacagaattcaccaacaagaacatgctgatgacagtcatttatttgctg
tttgctgggacgatgacggtcagcaccacggtcggctataccctcctgctcctgatgaaa
taccctcatgtccaaaagtgggtacgtgaggagctgaatcgggagctgggggctggccag
gcaccaagcctaggggaccgtacccgcctcccttacaccgacgcggttctgcatgaggcg
cagcggctgctggcgctggtgcccatgggaataccccgcaccctcatgcggaccacccgc
ttccgagggtacaccctgccccagggcacggaggtcttccccctccttggctccatcctg
catgaccccaacatcttcaagcacccagaagagttcaacccagaccgtttcctggatgca
gatggacggttcaggaagcatgaggcgttcctgcccttctccttagggaagcgtgtctgc
cttggagagggcctggcaaaagcggagctcttcctcttcttcaccaccatcctacaagcc
ttctccctggagagcccgtgcccgccggacaccctgagcctcaagcccaccgtcagtggc
cttttcaacattcccccagccttccagctgcaagtccgtcccactgaccttcactccacc
acgcagaccagatga

DBGET integrated database retrieval system