KEGG   Homo sapiens (human): 2979Help
Entry
2979              CDS       T01001                                 

Gene name
GUCA1B, GCAP2, GUCA2, RP48
Definition
(RefSeq) guanylate cyclase activator 1B
  KO
K08328  guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa (RP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    2979 (GUCA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 2979
NCBI-ProteinID: NP_002089
OMIM: 602275
HGNC: 4679
Ensembl: ENSG00000112599
Vega: OTTHUMG00000014697
Pharos: Q9UMX6(Tbio)
UniProt: Q9UMX6 Q7Z3V9
Position
6p21.1
AA seq 200 aa AA seqDB search
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG
IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML
QMDMNPSSWLAQQRRKSAMF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggagtttagctgggaggaggcggaggcagctggcgagatagatgtggcggag
ctccaggagtggtacaagaagtttgtgatggagtgccccagcggcacactctttatgcat
gagtttaagcgcttcttcaaggtcacagacgatgaggaggcctcccagtatgtagagggc
atgttccgagccttcgacaagaatggggacaacaccatcgacttcctggagtacgtggca
gctctgaatctcgtgctgaggggcaccctggagcacaagctgaagtggacattcaagatc
tatgataaggatggcaatggctgcatcgaccgcctggagctactcaacattgtggaggga
atttaccagctgaagaaagcctgccggcgagagctacaaactgagcaaggccagctgctc
acacccgaggaggtcgtggacaggatcttcctcctggtggatgagaatggagatggccag
ctgtctctgaacgagtttgttgaaggtgcccgtcgggacaagtgggtgatgaagatgctg
cagatggacatgaatcccagcagctggctcgctcagcagagacggaaaagtgccatgttc
tga

DBGET integrated database retrieval system