KEGG   Homo sapiens (human): 2979Help
Entry
2979              CDS       T01001                                 

Gene name
GUCA1B, GCAP2, GUCA2, RP48
Definition
guanylate cyclase activator 1B (retina)
Orthology
K08328  
guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Phototransduction
Disease
H00527  
Retinitis pigmentosa (RP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    2979 (GUCA1B)
   04740 Olfactory transduction
    2979 (GUCA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6p21.1
AA seq 200 aa AA seqDB search
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG
IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML
QMDMNPSSWLAQQRRKSAMF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggagtttagctgggaggaggcggaggcagctggcgagatagatgtggcggag
ctccaggagtggtacaagaagtttgtgatggagtgccccagcggcacactctttatgcat
gagtttaagcgcttcttcaaggtcacagacgatgaggaggcctcccagtatgtagagggc
atgttccgagccttcgacaagaatggggacaacaccatcgacttcctggagtacgtggca
gctctgaatctcgtgctgaggggcaccctggagcacaagctgaagtggacattcaagatc
tatgataaggatggcaatggctgcatcgaccgcctggagctactcaacattgtggaggga
atttaccagctgaagaaagcctgccggcgagagctacaaactgagcaaggccagctgctc
acacccgaggaggtcgtggacaggatcttcctcctggtggatgagaatggagatggccag
ctgtctctgaacgagtttgttgaaggtgcccgtcgggacaagtgggtgatgaagatgctg
cagatggacatgaatcccagcagctggctcgctcagcagagacggaaaagtgccatgttc
tga

DBGET integrated database retrieval system