KEGG   Homo sapiens (human): 29796Help
Entry
29796             CDS       T01001                                 

Gene name
UQCR10, HSPC051, HSPC151, QCR9, UCCR7.2, UCRC
Definition
ubiquinol-cytochrome c reductase, complex III subunit X
Orthology
K00419  
ubiquinol-cytochrome c reductase subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    29796 (UQCR10)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    29796 (UQCR10)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29796 (UQCR10)
   05012 Parkinson's disease
    29796 (UQCR10)
   05016 Huntington's disease
    29796 (UQCR10)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29796 (UQCR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.2
AA seq 62 aa AA seqDB search
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGVRACAIPDLG
PA
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgacgttgacttcgaaattgtactccctgctgttccgcaggacctccacc
ttcgccctcaccatcatcgtgggcgtcatgttcttcgagcgcgccttcgatcaaggcgcg
gacgctatctacgaccacatcaacgagggggtgagggcctgtgccatccctgaccttgga
cccgcctga

DBGET integrated database retrieval system