KEGG   Homo sapiens (human): 2982Help
Entry
2982              CDS       T01001                                 

Gene name
GUCY1A3, GC-SA3, GUC1A3, GUCA3, GUCSA3, GUCY1A1, MYMY6
Definition
guanylate cyclase 1, soluble, alpha 3 (EC:4.6.1.2)
Orthology
K12318  
guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Salivary secretion
Disease
H01396  
Moyamoya Disease
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    2982 (GUCY1A3)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    2982 (GUCY1A3)
 Cellular Processes
  Cell communication
   04540 Gap junction
    2982 (GUCY1A3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2982 (GUCY1A3)
  Endocrine system
   04921 Oxytocin signaling pathway
    2982 (GUCY1A3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    2982 (GUCY1A3)
  Digestive system
   04970 Salivary secretion
    2982 (GUCY1A3)
  Nervous system
   04730 Long-term depression
    2982 (GUCY1A3)
  Environmental adaptation
   04713 Circadian entrainment
    2982 (GUCY1A3)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     2982 (GUCY1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.1-q31.2
AA seq 690 aa AA seqDB search
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAE
QAVAAGVPVEVIKESLGEEVFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAY
QQGTNSKPCFQKKDVEDGNANFLGKASGID
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcacgaagctcaaggatctcaagatcacaggagagtgtcctttctccttactg
gcaccaggtcaagttcctaacgagtcttcagaggaggcagcaggaagctcagagagctgc
aaagcaaccgtgcccatctgtcaagacattcctgagaagaacatacaagaaagtcttcct
caaagaaaaaccagtcggagccgagtctatcttcacactttggcagagagtatttgcaaa
ctgattttcccagagtttgaacggctgaatgttgcacttcagagaacattggcaaagcac
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaacaattgcagag
caagcagttgcagcaggagttccagtggaggttatcaaagaatctcttggtgaagaggtt
tttaaaatatgttacgaggaagatgaaaacatccttggggtggttggaggcacccttaaa
gattttttaaacagcttcagtacccttctgaaacagagcagccattgccaagaagcagga
aaaaggggcaggcttgaggacgcctccattctatgcctggataaggaggatgattttcta
catgtttactacttcttccctaagagaaccacctccctgattcttcccggcatcataaag
gcagctgctcacgtattatatgaaacggaagtggaagtgtcgttaatgcctccctgcttc
cataatgattgcagcgagtttgtgaatcagccctacttgttgtactccgttcacatgaaa
agcaccaagccatccctgtcccccagcaaaccccagtcctcgctggtgattcccacatcg
ctattctgcaagacatttccattccatttcatgtttgacaaagatatgacaattctgcaa
tttggcaatggcatcagaaggctgatgaacaggagagactttcaaggaaagcctaatttt
gaagaatactttgaaattctgactccaaaaatcaaccagacgtttagcgggatcatgact
atgttgaatatgcagtttgttgtacgagtgaggagatgggacaactctgtgaaaaaatct
tcaagggttatggacctcaaaggccaaatgatctacattgttgaatccagtgcaatcttg
tttttggggtcaccctgtgtggacagattagaagattttacaggacgagggctctacctc
tcagacatcccaattcacaatgcactgagggatgtggtcttaataggggaacaagcccga
gctcaagatggcctgaagaagaggctggggaagctgaaggctacccttgagcaagcccac
caagccctggaggaggagaagaaaaagacagtagaccttctgtgctccatatttccctgt
gaggttgctcagcagctgtggcaagggcaagttgtgcaagccaagaagttcagtaatgtc
accatgctcttctcagacatcgttgggttcactgccatctgctcccagtgctcaccgctg
caggtcatcaccatgctcaatgcactgtacactcgcttcgaccagcagtgtggagagctg
gatgtctacaaggtggagaccattggcgatgcctattgtgtagctgggggattacacaaa
gagagtgatactcatgctgttcagatagcgctgatggccctgaagatgatggagctctct
gatgaagttatgtctccccatggagaacctatcaagatgcgaattggactgcactctgga
tcagtttttgctggcgtcgttggagttaaaatgccccgttactgtctttttggaaacaat
gtcactctggctaacaaatttgagtcctgcagtgtaccacgaaaaatcaatgtcagccca
acaacttacagattactcaaagactgtcctggtttcgtgtttacccctcgatcaagggag
gaacttccaccaaacttccctagtgaaatccccggaatctgccattttctggatgcttac
caacaaggaacaaactcaaaaccatgcttccaaaagaaagatgtggaagatggcaatgcc
aattttttaggcaaagcatcaggaatagattag

DBGET integrated database retrieval system