KEGG   Homo sapiens (human): 2983Help
Entry
2983              CDS       T01001                                 

Gene name
GUCY1B3, GC-S-beta-1, GC-SB3, GUC1B3, GUCB3, GUCSB3, GUCY1B1
Definition
guanylate cyclase 1, soluble, beta 3 (EC:4.6.1.2)
Orthology
K12319  
guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Vascular smooth muscle contraction
Gap junction
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Salivary secretion
Drug target
Other: 
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.3-q33
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagttgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgtgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctaccatctacccaggaatgcgtgcaccttccttt
aggtgcactgatgcagaaaagggcaaaggactcattttgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggcacaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctgtctgtcttctcgctggttcgtcctcat
attgatattagtttccatgggatcctttctcacatcaatactgtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctatgttcaccaagtgtcatgaacctggacgatttgacaaggagagggctgtatcta
agtgacatccctctgcatgatgccacgcgcgatcttgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacgtta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctccg
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctctttagtggcattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggagccatgaagatcgtcaacctcctcaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggttcaagtagatggtgaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttgggaatactgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccacttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

DBGET integrated database retrieval system