KEGG   Homo sapiens (human): 2983Help
Entry
2983              CDS       T01001                                 

Gene name
GUCY1B3, GC-S-beta-1, GC-SB3, GUC1B3, GUCB3, GUCSB3, GUCY1B1
Definition
guanylate cyclase 1, soluble, beta 3 (EC:4.6.1.2)
Orthology
K12319  
guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Salivary secretion
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    2983 (GUCY1B3)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    2983 (GUCY1B3)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    2983 (GUCY1B3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2983 (GUCY1B3)
  Endocrine system
   04921 Oxytocin signaling pathway
    2983 (GUCY1B3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    2983 (GUCY1B3)
  Digestive system
   04970 Salivary secretion
    2983 (GUCY1B3)
  Nervous system
   04730 Long-term depression
    2983 (GUCY1B3)
  Environmental adaptation
   04713 Circadian entrainment
    2983 (GUCY1B3)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     2983 (GUCY1B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.3-q33
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagttgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgtgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctaccatctacccaggaatgcgtgcaccttccttt
aggtgcactgatgcagaaaagggcaaaggactcattttgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggcacaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctgtctgtcttctcgctggttcgtcctcat
attgatattagtttccatgggatcctttctcacatcaatactgtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctatgttcaccaagtgtcatgaacctggacgatttgacaaggagagggctgtatcta
agtgacatccctctgcatgatgccacgcgcgatcttgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacgtta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctccg
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctctttagtggcattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggagccatgaagatcgtcaacctcctcaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggttcaagtagatggtgaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttgggaatactgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccacttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

DBGET integrated database retrieval system