KEGG   Homo sapiens (human): 29850Help
Entry
29850             CDS       T01001                                 

Gene name
TRPM5, LTRPC5, MTR1
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 5
  KO
K04980  
transient receptor potential cation channel subfamily M member 5
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    29850 (TRPM5)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   29850 (TRPM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.5
AA seq 1165 aa AA seqDB search
MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEW
HLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAV
RDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNL
SHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERI
SRAVEQAAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWT
KLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDR
VDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYR
SVSRKSLLFDLLQRKQEEARLTLAGLGTQQAREPPAGPPAFSLHEVSRVLKDFLQDACRG
FYQDGRPGDRRRAEKGPAKRPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAM
GQEGVAAALAACKILKEMSHLETEAEAARATREAKYERLALDLFSECYSNSEARAFALLV
RRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAFLCPALV
YTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVFL
LTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGPEVTLYFWVFTLVL
EEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPSAFEAGRTVLAM
DFMVFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDG
RLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLV
TFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHL
SLTLRRVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRK
TAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVADVLAQGGGPRSSQHCGEGSQ
LVAADHRGGLDGWEQPGAGQPPSDT
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgtccaaggcccccgtcccggaagccccggggatgctgaagaccggcgggag
ctgggcttgcacaggggcgaggtcaactttggagggtctgggaagaagcgaggcaagttt
gtacgggtgccgagcggagtggccccgtctgtgctctttgacctgctgcttgctgagtgg
cacctgccggcccccaacctggtggtgtccctggtgggtgaggagcagcctttcgccatg
aagtcctggctgcgggatgtgctgcgcaaggggctggtgaaggcggctcagagcacagga
gcctggatcctgaccagtgccctccgcgtgggcctggccaggcatgtcgggcaggccgtg
cgcgaccactcgctggccagcacgtccaccaaggtccgtgtggttgctgtcggcatggcc
tcgctgggccgcgtcctgcaccgccgcattctggaggaggcccaggaggattttcctgtc
cactaccctgaggatgacggcggcagccagggccccctctgttcactggacagcaacctc
tcccacttcatcctggtggagccaggccccccggggaagggcgatgggctgacggagctg
cggctgaggctggagaagcacatctcggagcagagggcgggctacgggggcactggcagc
atcgagatccctgtcctctgcttgctggtcaatggtgatcccaacaccttggagaggatc
tccagggccgtggagcaggctgccccgtggctgatcctggtaggctcggggggcatcgcc
gatgtgcttgctgccctagtgaaccagccccacctcctggtgcccaaggtggccgagaag
cagtttaaggagaagttccccagcaagcatttctcttgggaggacatcgtgcgctggacc
aagctgctgcagaacatcacctcacaccagcacctgctcaccgtgtatgacttcgagcag
gagggctccgaggagctggacacggtcatcctgaaggcgctggtgaaagcctgcaagagc
cacagccaggagcctcaggactatctggatgagctcaagctggccgtggcctgggaccgc
gtggacatcgccaagagtgagatcttcaatggggacgtggagtggaagtcctgtgacctg
gaggaggtgatggtggacgccctggtcagcaacaagcccgagtttgtgcgcctctttgtg
gacaacggcgcagacgtggccgacttcctgacgtatgggcggctgcaggagctctaccgc
tccgtgtcacgcaagagcctgctcttcgacctgctgcagcggaagcaggaggaggcccgg
ctgacgctggccggcctgggcacccagcaggcccgggagccacccgcggggccaccggcc
ttctccctgcacgaggtctcccgcgtactcaaggacttcctgcaggacgcctgccgaggc
ttctaccaggacggccggccaggggaccgcaggagggcggagaagggcccggccaagcgg
cccacgggccagaagtggctgctggacctgaaccagaagagcgagaacccctggcgggac
ctgttcctgtgggccgtgctgcagaaccgccacgagatggccacctacttctgggccatg
ggccaggaaggtgtggcagccgcactggccgcctgcaaaatcctcaaagagatgtcgcac
ctggagacggaggccgaggcggcccgagccacgcgcgaggcgaaatacgagcggctggcc
cttgacctcttctccgagtgctacagcaacagtgaggcccgcgccttcgccctgctggtg
cgccggaaccgctgctggagcaagaccacctgcctgcacctggccaccgaggctgacgcc
aaggccttctttgcccacgacggcgttcaggccttcctgaccaggatctggtggggggac
atggccgcaggcacgcccatcctgcggctgctaggagccttcctctgccccgccctcgtc
tataccaacctcatcaccttcagtgaggaagctcccctgaggacaggcctggaggacctg
caggacctggacagcctggacacggagaagagcccgctgtatggcctgcagagccgggtg
gaggagctggtggaggcgccgagggctcagggtgaccgaggcccacgtgctgtcttcctg
ctcacacgctggcggaaattctggggcgctcccgtgactgtgttcctggggaacgtggtc
atgtacttcgccttcctcttcctgttcacctacgtcctgctggtggacttcaggccgccc
ccccagggcccctcagggcccgaggtcaccctctacttctgggtctttacgctggtgctg
gaggaaatccggcagggcttcttcacagacgaggacacacacctggtgaagaagttcaca
ctgtatgtgggggacaactggaacaagtgtgacatggtggccatcttcctgttcatcgtg
ggtgtcacctgcaggatgctgccgtcggcgtttgaggctggccgcacagtcctcgccatg
gacttcatggtgttcacgctgcggctgatccatatctttgccatacacaagcagctgggc
cccaagatcatcgtggtagagcgcatgatgaaggacgtcttcttcttcctcttctttctg
agcgtgtggctcgtggcctacggtgtcaccacccaggcgctgctgcacccccatgacggc
cgcctggagtggatcttccgccgggtgctctaccggccctacctgcagatcttcggccag
atcccactggacgagattgatgaagcccgtgtgaactgctccacccacccactgctgctg
gaggactcaccatcctgccccagcctctatgccaactggctggtcatcctcctgctggtc
accttcctgttggtcaccaatgtgctgctcatgaacctgctcatcgccatgttcagctac
acgttccaggtggtgcagggcaacgcagacatgttctggaagttccagcgctacaacctg
attgtggagtaccacgagcgccccgccctggccccgcccttcatcctgctcagccacctg
agcctgacgctccgccgggtcttcaagaaggaggctgagcacaagcgggagcacctggag
agagacctgccagaccccctggaccagaaggtcgtcacctgggagacagtccagaaggag
aacttcctgagcaagatggagaagcggaggagggacagcgagggggaggtgctgcggaaa
accgcccacagagtggacttcattgccaagtacctcgggggtctgagagagcaagaaaag
cgcatcaagtgtctggagtcacagatcaactactgctcggtgctcgtgtcctccgtggct
gacgtgctggcccagggtggcggcccccggagctctcagcactgtggcgagggaagccag
ctggtggctgctgaccacagaggtggtttagatggctgggaacaacccggggctggccag
cctccctcggacacctga

DBGET integrated database retrieval system