KEGG   Homo sapiens (human): 29851Help
Entry
29851             CDS       T01001                                 

Gene name
ICOS, AILIM, CD278, CVID1
Definition
(RefSeq) inducible T cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05340  Primary immunodeficiency
Disease
H00088  Common variable immunodeficiency (CVID)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    29851 (ICOS)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    29851 (ICOS)
   04672 Intestinal immune network for IgA production
    29851 (ICOS)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    29851 (ICOS)
CD molecules [BR:hsa04090]
 Proteins
  29851 (ICOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2 V-set
Motif
Other DBs
NCBI-GeneID: 29851
NCBI-ProteinID: NP_036224
OMIM: 604558
HGNC: 5351
Ensembl: ENSG00000163600
Vega: OTTHUMG00000132880
Pharos: Q9Y6W8(Tbio)
UniProt: Q9Y6W8 Q53QY6
Position
2q33.2
AA seq 199 aa AA seqDB search
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
MFMRAVNTAKKSRLTDVTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaggcctctggtatttctttctcttctgcttgcgcattaaagttttaacagga
gaaatcaatggttctgccaattatgagatgtttatatttcacaacggaggtgtacaaatt
ttatgcaaatatcctgacattgtccagcaatttaaaatgcagttgctgaaaggggggcaa
atactctgcgatctcactaagacaaaaggaagtggaaacacagtgtccattaagagtctg
aaattctgccattctcagttatccaacaacagtgtctctttttttctatacaacttggac
cattctcatgccaactattacttctgcaacctatcaatttttgatcctcctccttttaaa
gtaactcttacaggaggatatttgcatatttatgaatcacaactttgttgccagctgaag
ttctggttacccataggatgtgcagcctttgttgtagtctgcattttgggatgcatactt
atttgttggcttacaaaaaagaagtattcatccagtgtgcacgaccctaacggtgaatac
atgttcatgagagcagtgaacacagccaaaaaatctagactcacagatgtgaccctataa

DBGET integrated database retrieval system