KEGG   Homo sapiens (human): 29851Help
Entry
29851             CDS       T01001                                 

Gene name
ICOS, AILIM, CD278, CVID1
Definition
(RefSeq) inducible T-cell costimulator
  KO
K06713  
inducible T-cell co-stimulator
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
T cell receptor signaling pathway
Intestinal immune network for IgA production
Primary immunodeficiency
Disease
H00088  
Common variable immunodeficiency (CVID)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    29851 (ICOS)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    29851 (ICOS)
   04672 Intestinal immune network for IgA production
    29851 (ICOS)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    29851 (ICOS)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    ICOSLG, ICOSL; inducible T-cell co-stimulator ligand [KO:K06710]
     29851 (ICOS)
Cellular antigens [BR:hsa04090]
 Proteins
  29851 (ICOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9Y6W8(Tbio)
UniProt: 
Position
2q33.2
AA seq 199 aa AA seqDB search
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
MFMRAVNTAKKSRLTDVTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaggcctctggtatttctttctcttctgcttgcgcattaaagttttaacagga
gaaatcaatggttctgccaattatgagatgtttatatttcacaacggaggtgtacaaatt
ttatgcaaatatcctgacattgtccagcaatttaaaatgcagttgctgaaaggggggcaa
atactctgcgatctcactaagacaaaaggaagtggaaacacagtgtccattaagagtctg
aaattctgccattctcagttatccaacaacagtgtctctttttttctatacaacttggac
cattctcatgccaactattacttctgcaacctatcaatttttgatcctcctccttttaaa
gtaactcttacaggaggatatttgcatatttatgaatcacaactttgttgccagctgaag
ttctggttacccataggatgtgcagcctttgttgtagtctgcattttgggatgcatactt
atttgttggcttacaaaaaagaagtattcatccagtgtgcacgaccctaacggtgaatac
atgttcatgagagcagtgaacacagccaaaaaatctagactcacagatgtgaccctataa

DBGET integrated database retrieval system