KEGG   Homo sapiens (human): 29881Help
Entry
29881             CDS       T01001                                 

Gene name
NPC1L1, NPC11L1
Definition
NPC1-like 1
Orthology
K14461  
Niemann-Pick C1-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Drug target
Ezetimibe: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    29881 (NPC1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p13
AA seq 1332 aa AA seqDB search
MAEAGLRGWLLWALLLRLAQSEPYTTIHQPGYCAFYDECGKNPELSGSLMTLSNVSCLSN
TPARKITGDHLILLQKICPRLYTGPNTQACCSAKQLVSLEASLSITKALLTRCPACSDNF
VNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAYEAFYQHSFAEQSYDSCSRVRVPAA
ATLAVGTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGV
ARCNESQGDDVATCSCQDCAASCPAIARPQALDSTFYLGQMPGSLVLIIILCSVFAVVTI
LLVGFRVAPARDKSKMVDPKKGTSLSDKLSFSTHTLLGQFFQGWGTWVASWPLTILVLSV
IPVVALAAGLVFTELTTDPVELWSAPNSQARSEKAFHDQHFGPFFRTNQVILTAPNRSSY
RYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNT
SLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTSQVDWKDHFLYCANAPLTFKDGTALAL
SCMADYGAPVFPFLAIGGYKGKDYSEAEALIMTFSLNNYPAGDPRLAQAKLWEEAFLEEM
RAFQRRMAGMFQVTFMAERSLEDEINRTTAEDLPIFATSYIVIFLYISLALGSYSSWSRV
MVDSKATLGLGGVAVVLGAVMAAMGFFSYLGIRSSLVILQVVPFLVLSVGADNIFIFVLE
YQRLPRRPGEPREVHIGRALGRVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAV
ILDFLLQMSAFVALLSLDSKRQEASRLDVCCCVKPQELPPPGQGEGLLLGFFQKAYAPFL
LHWITRGVVLLLFLALFGVSLYSMCHISVGLDQELALPKDSYLLDYFLFLNRYFEVGAPV
YFVTTLGYNFSSEAGMNAICSSAGCNNFSFTQKIQYATEFPEQSYLAIPASSWVDDFIDW
LTPSSCCRLYISGPNKDKFCPSTVNSLNCLKNCMSITMGSVRPSVEQFHKYLPWFLNDRP
NIKCPKGGLAAYSTSVNLTSDGQVLASRFMAYHKPLKNSQDYTEALRAARELAANITADL
RKVPGTDPAFEVFPYTITNVFYEQYLTILPEGLFMLSLCLVPTFAVSCLLLGLDLRSGLL
NLLSIVMILVDTVGFMALWGISYNAVSLINLVSAVGMSVEFVSHITRSFAISTKPTWLER
AKEATISMGSAVFAGVAMTNLPGILVLGLAKAQLIQIFFFRLNLLITLLGLLHGLVFLPV
ILSYVGPDVNPALALEQKRAEEAVAAVMVASCPNHPSRVSTADNIYVNHSFEGSIKGAGA
ISNFLPNNGRQF
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggccggcctgaggggctggctgctgtgggccctgctcctgcgcttggcccag
agtgagccttacacaaccatccaccagcctggctactgcgccttctatgacgaatgtggg
aagaacccagagctgtctggaagcctcatgacactctccaacgtgtcctgcctgtccaac
acgccggcccgcaagatcacaggtgatcacctgatcctattacagaagatctgcccccgc
ctctacaccggccccaacacccaagcctgctgctccgccaagcagctggtatcactggaa
gcgagtctgtcgatcaccaaggccctcctcacccgctgcccagcctgctctgacaatttt
gtgaacctgcactgccacaacacgtgcagccccaatcagagcctcttcatcaatgtgacc
cgcgtggcccagctaggggctggacaactcccagctgtggtggcctatgaggccttctac
cagcatagctttgccgagcagagctatgactcctgcagccgtgtgcgcgtccctgcagct
gccacgctggctgtgggcaccatgtgtggcgtgtatggctctgccctttgcaatgcccag
cgctggctcaacttccagggagacacaggcaatggtctggccccactggacatcaccttc
cacctcttggagcctggccaggccgtggggagtgggattcagcctctgaatgagggggtt
gcacgttgcaatgagtcccaaggtgacgacgtggcgacctgctcctgccaagactgtgct
gcatcctgtcctgccatagcccgcccccaggccctcgactccaccttctacctgggccag
atgccgggcagtctggtcctcatcatcatcctctgctctgtcttcgctgtggtcaccatc
ctgcttgtgggattccgtgtggcccccgccagggacaaaagcaagatggtggaccccaag
aagggcaccagcctctctgacaagctcagcttctccacccacaccctccttggccagttc
ttccagggctggggcacgtgggtggcttcgtggcctctgaccatcttggtgctatctgtc
atcccggtggtggccttggcagcgggcctggtctttacagaactcactacggaccccgtg
gagctgtggtcggcccccaacagccaagcccggagtgagaaagctttccatgaccagcat
ttcggccccttcttccgaaccaaccaggtgatcctgacggctcctaaccggtccagctac
aggtatgactctctgctgctggggcccaagaacttcagcggaatcctggacctggacttg
ctgctggagctgctagagctgcaggagaggctgcggcacctccaggtatggtcgcccgaa
gcacagcgcaacatctccctgcaggacatctgctacgcccccctcaatccggacaatacc
agtctctacgactgctgcatcaacagcctcctgcagtatttccagaacaaccgcacgctc
ctgctgctcacagccaaccagacactgatggggcagacctcccaagtcgactggaaggac
cattttctgtactgtgccaatgccccgctcaccttcaaggatggcacagccctggccctg
agctgcatggctgactacggggcccctgtcttccccttccttgccattggggggtacaaa
ggaaaggactattctgaggcagaggccctgatcatgacgttctccctcaacaattaccct
gccggggacccccgtctggcccaggccaagctgtgggaggaggccttcttagaggaaatg
cgagccttccagcgtcggatggctggcatgttccaggtcacgttcatggctgagcgctct
ctggaagacgagatcaatcgcaccacagctgaagacctgcccatctttgccaccagctac
attgtcatattcctgtacatctctctggccctgggcagctattccagctggagccgagtg
atggtggactccaaggccacgctgggcctcggcggggtggccgtggtcctgggagcagtc
atggctgccatgggcttcttctcctacttgggtatccgctcctccctggtcatcctgcaa
gtggttcctttcctggtgctgtccgtgggggctgataacatcttcatctttgttctcgag
taccagaggctgccccggaggcctggggagccacgagaggtccacattgggcgagcccta
ggcagggtggctcccagcatgctgttgtgcagcctctctgaggccatctgcttcttccta
ggggccctgacccccatgccagctgtgcggacctttgccctgacctctggccttgcagtg
atccttgacttcctcctgcagatgtcagcctttgtggccctgctctccctggacagcaag
aggcaggaggcctcccggttggacgtctgctgctgtgtcaagccccaggagctgcccccg
cctggccagggagaggggctcctgcttggcttcttccaaaaggcttatgcccccttcctg
ctgcactggatcactcgaggtgttgtgctgctgctgtttctcgccctgttcggagtgagc
ctctactccatgtgccacatcagcgtgggactggaccaggagctggccctgcccaaggac
tcgtacctgcttgactatttcctctttctgaaccgctacttcgaggtgggggccccggtg
tactttgttaccaccttgggctacaacttctccagcgaggctgggatgaatgccatctgc
tccagtgcaggctgcaacaacttctccttcacccagaagatccagtatgccacagagttc
cctgagcagtcttacctggccatccctgcctcctcctgggtggatgacttcattgactgg
ctgaccccgtcctcctgctgccgcctttatatatctggccccaataaggacaagttctgc
ccctcgaccgtcaactctctgaactgcctaaagaactgcatgagcatcacgatgggctct
gtgaggccctcggtggagcagttccataagtatcttccctggttcctgaacgaccggccc
aacatcaaatgtcccaaaggcggcctggcagcatacagcacctctgtgaacttgacttca
gatggccaggttttagcctccaggttcatggcctatcacaagcccctgaaaaactcacag
gattacacagaagctctgcgggcagctcgagagctggcagccaacatcactgctgacctg
cggaaagtgcctggaacagacccggcttttgaggtcttcccctacacgatcaccaatgtg
ttttatgagcagtacctgaccatcctccctgaggggctcttcatgctcagcctctgcctt
gtgcccaccttcgctgtctcctgcctcctgctgggcctggacctgcgctccggcctcctc
aacctgctctccattgtcatgatcctcgtggacactgtcggcttcatggccctgtggggc
atcagttacaatgctgtgtccctcatcaacctggtctcggcggtgggcatgtctgtggag
tttgtgtcccacattacccgctcctttgccatcagcaccaagcccacctggctggagagg
gccaaagaggccaccatctctatgggaagtgcggtgtttgcaggtgtggccatgaccaac
ctgcctggcatccttgtcctgggcctcgccaaggcccagctcattcagatcttcttcttc
cgcctcaacctcctgatcactctgctgggcctgctgcatggcttggtcttcctgcccgtc
atcctcagctacgtggggcctgacgttaacccggctctggcactggagcagaagcgggct
gaggaggcggtggcagcagtcatggtggcctcttgcccaaatcacccctcccgagtctcc
acagctgacaacatctatgtcaaccacagctttgaaggttctatcaaaggtgctggtgcc
atcagcaacttcttgcccaacaatgggcggcagttctga

DBGET integrated database retrieval system