KEGG   Homo sapiens (human): 29882Help
Entry
29882             CDS       T01001                                 

Gene name
ANAPC2, APC2
Definition
anaphase promoting complex subunit 2
Orthology
K03349  
anaphase-promoting complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29882 (ANAPC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    29882 (ANAPC2)
   04114 Oocyte meiosis
    29882 (ANAPC2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29882 (ANAPC2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    29882 (ANAPC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    Cullin
     29882 (ANAPC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 822 aa AA seqDB search
MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVE
VLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLES
RLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCF
LRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIED
LKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIR
NVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
WPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVT
PVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMF
VVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagttgtggtggcggagggggacagcgactcccggcccggacaggagttg
ttagtggcctggaacaccgtgagcaccggcctggtgccgccggctgcgctggggctggtg
tcttcccggaccagcggtgcagtcccgccaaaggaagaggagctccgggcggcggtggag
gttctgaggggccacgggctacactcggtcctggaggagtggttcgtggaggtgctgcag
aacgatctgcaggccaacatctcccctgagttctggaatgccatctcccaatgcgagaac
tctgcggatgagccccagtgccttttgctactccttgacgcttttggcctgctggagagc
cgcctggatccctacctgcgtagcctagagctgctggagaaatggactcgcctgggcttg
ctgatgggcactggtgctcaggggctgcgagaagaagtccacactatgttgcgcggagtc
ttgttctttagcacccccagaaccttccaagagatgatccagcgtctgtatgggtgcttc
ttgagagtctatatgcagagtaagaggaagggggaagggggcacagacccggaactggaa
ggggagctggacagccggtatgcccgtcgccggtactaccggctcctgcagagcccgctg
tgtgcagggtgcagcagtgacaagcaacagtgctggtgtcgccaggctctggagcagttc
catcagctcagccaggtcttacacaggctcagtctgctggagcgggtcagtgccgaggct
gtgaccaccaccctgcaccaggtgacccgggagaggatggaggaccgttgccggggcgag
tacgagcgctccttcctgcgtgagttccacaagtggatcgagcgggtggtcggctggctc
ggcaaggtgttcctgcaggacggccccgccaggcccgcatctcccgaggccggcaacacc
ctgcgccgctggcgctgccacgtgcaaaggttcttctaccgcatctacgccagcctgcgc
atcgaggagctcttcagcatcgtccgagacttcccagactcccggccagccatcgaggac
ctcaagtactgcctggagaggacggaccagaggcagcagctgctcgtgtccctcaaggct
gccctggagactcggctcctgcatccaggcgtcaacacgtgtgacatcatcaccctctat
atctctgccatcaaggcgctgcgcgtgctggacccttccatggtcatcctggaggtggcc
tgtgagcctatccgccgctacctgaggacgcgggaggacacagtgcggcagattgtggct
gggctgacgggggactcggacgggacaggggacctggctgttgagctgtccaagaccgac
ccggcgagcctggagacaggccaggacagtgaggatgactcaggcgagccagaggactgg
gtcccggaccctgtggatgccgatccagggaagtcgagctccaagcggcgttcatcggac
atcatcagcctgctggtcagcatctacggcagcaaggacctcttcatcaatgagtaccgc
tcgctgctggccgaccgcctgctgcaccagttcagcttcagccccgagcgggagatccgc
aacgtggagctgctgaagctgcgctttggcgaggccccaatgcacttctgtgaagtcatg
ctgaaggacatggcggactcccgccgcatcaatgccaacatccgggaggaggatgagaag
cggccagcagaggagcagccaccgttcggggtctacgctgtcatcctgtccagtgagttc
tggccgcccttcaaggacgagaagctggaggtccccgaggatatcagggcagccctggag
gcttactgcaagaagtatgagcagctcaaggccatgcggaccctcagttggaagcacacc
ctgggcctggtgaccatggacgtggagctggccgaccgcacgctgtctgtggcggtcacc
ccagtacaggcggtgatcttgctgtattttcaggaccaagccagctggaccctggaggaa
ctgagcaaggcggtgaagatgcccgtggcgctgctgcggcggcggatgtccgtgtggctg
cagcagggtgtgctgcgtgaggagccccccggcaccttctctgtcattgaggaggagcgg
cctcaggaccgggacaacatggtgctcattgacagtgacgacgagagcgactccggcatg
gcctcccaggccgaccagaaggaggaggagctgctgctcttctggacgtacatccaggcc
atgctgaccaacctggagagcctctcactggatcgtatctacaacatgctccgcatgttt
gtggtgactgggcctgcactggccgagattgacctgcaggagctgcagggctacctgcag
aagaaggtgcgggaccagcagctcgtctactcggccggcgtctaccgcctgcccaagaac
tgcagctga

DBGET integrated database retrieval system