KEGG   Homo sapiens (human): 29889Help
Entry
29889             CDS       T01001                                 

Gene name
GNL2, HUMAUANTIG, NGP1, Ngp-1, Nog2, Nug2
Definition
(RefSeq) G protein nucleolar 2
  KO
K14537  
nuclear GTP-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    29889 (GNL2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    29889 (GNL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13823(Tbio)
UniProt: 
Position
1p34.3
AA seq 731 aa AA seqDB search
MVKPKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNMYRQKERRNSRGKIIKPL
QYQSTVASGTVARVEPNIKWFGNTRVIKQSSLQKFQEEMDTVMKDPYKVVMKQSKLPMSL
LHDRIRPHNLKVHILDTESFETTFGPKSQRKRPNLFASDMQSLIENAEMSTESYDQGKDR
DLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIETY
LKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHASLTNPFGKGAFIQLLRQ
FGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLI
DCPGVVYPSEDSETDIVLKGVVQVEKIKSPEDHIGAVLERAKPEYISKTYKIDSWENAED
FLEKLAFRTGKLLKGGEPDLQTVGKMVLNDWQRGRIPFFVKPPNAEPLVAPQLLPSSSLE
VVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVP
QFSGDDLVPVEVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKAL
DEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRK
AQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYETHNVKNRNRNKKKTNDSEGQ
KHKRKKFRQKQ
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcccaagtacaaaggacggagcaccatcaacccgtccaaggccagcacaaac
ccagatcgagtgcagggagcaggaggccaaaacatgagggaccgggccaccatccggcgc
ctgaatatgtataggcaaaaggagcgcaggaacagtcgtggtaaaataattaaacccctg
caatatcaatcaacggtggcttctggcacagtggcaagagtagagccaaatattaaatgg
tttggaaacacacgtgtgattaagcagtcatcattacaaaaatttcaagaggaaatggat
acagttatgaaggatccatacaaagttgtcatgaagcaaagcaagttaccaatgtctctt
ctccatgatcgaatccggcctcataacttgaaggtgcacattcttgatactgaaagtttt
gaaactacatttggccctaagtcacagaggaaacgaccaaacttatttgcaagtgatatg
cagtctcttatcgaaaatgctgaaatgtccactgagagctatgaccagggcaaggatcgt
gatttggtaactgaagacactggtgtgagaaatgaagctcaagaagagatctataaaaag
ggacagtccaaaagaatatggggtgagctctacaaggtgatagattcatcagatgttgta
gttcaagttcttgatgctagagatccaatgggtactcgttcccctcacattgaaacttac
ctgaagaaggaaaaaccttggaaacacctcatttttgtacttaacaaatgtgaccttgtt
ccaacctgggcaacaaaacggtgggttgctgtcctctcccaggattatccaacacttgct
ttccatgcaagccttactaacccgtttggcaagggagcattcattcagcttctgcggcag
tttggaaagttgcacactgacaagaaacagatcagtgttgggttcattggctatccaaat
gttggcaagagctctgtgataaatacattgcgttctaagaaagtttgcaacgtggctccc
attgcaggtgaaacaaaggtctggcagtatattactttgatgcgtcggatattcctgatt
gactgtccaggtgtggtttacccctctgaggactccgagacagacattgtgctaaaagga
gttgttcaagtagaaaaaattaagagtcctgaagaccacattggtgctgtacttgaacga
gcaaagccagaatatatcagcaaaacatacaagattgattcttgggagaatgctgaggac
tttcttgagaagctcgctttccggactgggaagttactaaagggtggagagcccgacttg
cagactgtgggtaagatggtcctcaatgactggcagaggggccggattcctttctttgtc
aagccacccaatgcagagccacttgtggccccccagcttctaccctcctcatctttggaa
gttgtcccagaagcagcccagaacaatccaggggaggaagtcacagaaactgcaggtgaa
gggtcagaatccatcattaaggaagaaacagaagagaacagtcactgtgatgctaacaca
gagatgcagcagattctcacacgagttcggcagaactttggtaaaatcaacgtggtgcct
cagttttctggggatgacctggttcctgtggaggtgtcagatcttgaggaagagcttgag
agcttttctgatgaagaggaggaggaacaggagcaacaaagagatgatgcggaagagtct
tcctcggagcctgaggaggaaaatgtgggaaacgacaccaaagccgttattaaagcactg
gatgagaagattgccaaatatcagaagtttctagacaaagccaaagccaaaaagttttca
gcagtcagaatatccaagggactgagtgaaaagatatttgcaaaacctgaagaacaaaga
aaaacactggaagaagatgtagatgacagagcaccttccaaaaagggaaagaagcggaag
gcacaaagggaagaggaacaggaacattcaaataaagctcccagggcgcttacatcaaaa
gaacggaggcgagcagtacgacagcaacggccgaaaaaagttggtgtgcgctactatgaa
acacacaacgtgaaaaataggaacaggaacaaaaagaagaccaatgactcagagggacag
aaacacaaacgcaaaaaattcagacaaaagcagtaa

DBGET integrated database retrieval system