KEGG   Homo sapiens (human): 29894Help
Entry
29894             CDS       T01001                                 

Gene name
CPSF1, CPSF160, HSU37012, P/cl.18
Definition
cleavage and polyadenylation specific factor 1, 160kDa
Orthology
K14401  
cleavage and polyadenylation specificity factor subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.23
AA seq 1443 aa AA seqDB search
MYAVYKQAHPPTGLEFSMYCNFFNNSERNLVVAGTSQLYVYRLNRDAEALTKNDRSTEGK
AHREKLELAASFSFFGNVMSMASVQLAGAKRDALLLSFKDAKLSVVEYDPGTHDLKTLSL
HYFEEPELRDGFVQNVHTPRVRVDPDGRCAAMLVYGTRLVVLPFRRESLAEEHEGLVGEG
QRSSFLPSYIIDVRALDEKLLNIIDLQFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSI
VAISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVAL
NSLTTGTTAFPLRTQEGVRITLDCAQATFISYDKMVISLKGGEIYVLTLITDGMRSVRAF
HFDKAAASVLTTSMVTMEPGYLFLGSRLGNSLLLKYTEKLQEPPASAVREAADKEEPPSK
KKRVDATAGWSAAGKSVPQDEVDEIEVYGSEAQSGTQLATYSFEVCDSILNIGPCANAAV
GEPAFLSEEFQNSPEPDLEIVVCSGHGKNGALSVLQKSIRPQVVTTFELPGCYDMWTVIA
PVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSREDSTMILQTGQEIMELDTSGF
ATQGPTVFAGNIGDNRYIVQVSPLGIRLLEGVNQLHFIPVDLGAPIVQCAVADPYVVIMS
AEGHVTMFLLKSDSYGGRHHRLALHKPPLHHQSKVITLCLYRDLSGMFTTESRLGGARDE
LGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAE
PTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQ
GELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNIN
FREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSPHWLLVTGRGA
LRLHPMAIDGPVDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPVRKIPLRC
TAHYVAYHVESKVYAVATSTNTPCARIPRMTGEEKEFETIERDERYIHPQQEAFSIQLIS
PVSWEAIPNARIELQEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQGEEVTCRGRIL
IMDVIEVVPEPGQPLTKNKFKVLYEKEQKGPVTALCHCNGHLVSAIGQKIFLWSLRASEL
TGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEESKTLSLVSRDAKPLEVYSVDF
MVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLRRADFHVGAHVNTFWRTPCRGAT
EGLSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYRRLLMLQNALTTMLPHHAGLNPRA
FRMLHVDRRTLQNAVRNVLDGELLNRYLYLSTMERSELAKKIGTTPDIILDDLLETDRVT
AHF
NT seq 4332 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccgtgtacaaacaggcgcatccgcccaccggtctggagttctccatgtactgc
aacttcttcaacaacagcgagcgcaacctggtagtggccgggacctcgcagctctacgtg
taccgcctcaaccgcgacgccgaggctctgaccaagaatgacaggagcacagaggggaag
gcccaccgggagaagctcgagcttgctgcctccttctccttctttggcaacgtcatgtcc
atggccagcgtgcagctggcaggagccaagcgggatgccctgctcctaagcttcaaggat
gccaagctgtctgtggtggagtacgacccgggcacccatgacctgaagaccctgtcactg
cactactttgaggagcctgagcttcgggacgggtttgtgcagaatgtacacacgccgcga
gtgcgggtggaccccgacgggcgctgtgcagccatgcttgtctacggcacgcggctggtg
gtcctgcccttccgcagggagagcctggctgaggagcacgaggggctcgtgggtgagggg
cagaggtccagcttcctgcccagctacatcatcgacgtgcgggccctagacgagaagctg
ctcaacatcatcgacctgcagttcctgcatggctactacgagcctaccctcctcatcctg
tttgagcccaaccagacctggcctgggcgcgtggccgtgcggcaggacacgtgctccatt
gtggccatctcactgaacatcacgcagaaggtgcaccccgtcatctggtccctcaccagc
ctgccctttgactgcacccaggctctggctgtgcccaagcccataggtggggtggtggtg
tttgccgtcaactcgctgttgtacctgaaccagagcgtccccccgtatggcgtggctctc
aacagcctcaccacaggaaccacggctttcccgcttcgcacccaggagggtgtgcggatc
accctggactgcgcccaggccaccttcatctcctacgacaagatggtcatctccctcaag
ggcggcgagatctacgtgctgaccctcatcaccgacggcatgcgcagtgtccgagcgttc
cactttgacaaggcggccgccagcgtcctcaccaccagcatggtcaccatggagcccggg
tacctgttcctgggttctcgcctgggcaattccctcctcctcaagtacacggagaagctg
caggagcccccggccagtgctgtccgtgaggctgccgacaaggaagagcctccctcaaag
aagaagcgagtggatgcgacggccggctggtcagctgcgggtaagtcggtgccgcaggat
gaggtggacgagattgaagtgtacggcagcgaggcccagtcgggaacacagctggccacc
tactcctttgaggtgtgtgacagcatcctgaacattggaccctgtgccaatgccgccgtg
ggcgagcctgccttcctctctgaagagtttcagaacagccccgagccggacctggagatt
gtggtttgctccggccacgggaagaacggggctttgtcggtgctgcagaagagcatccgg
ccccaggtggtgacaacctttgagcttcccggctgctatgacatgtggacagtcatcgcc
ccggtgcgtaaggaggaggaggacaatcccaagggggagggcacagagcaggaacccagc
accacccctgaagcagacgacgacggccgcagacacggattcctgattctgagccgggaa
gactccaccatgatcctgcagacggggcaggagatcatggagctggacaccagtggcttc
gccactcagggccccacggtctttgctgggaacatcggggacaaccgctacattgtccaa
gtgtcaccactgggcatccgcctgctggaaggagtgaatcagctgcacttcatccccgtg
gacctgggcgcccccatcgtgcagtgcgccgtggccgacccctatgtggtcatcatgagt
gccgagggccacgtcaccatgttcctgctgaagagtgactcctacggtggccgccaccac
cgcctggcgctgcacaagcccccgctgcaccatcagtccaaggtgattacgctgtgcctg
taccgagacctcagcggcatgttcaccactgagagccgcctgggtggggcccgtgacgag
ctcgggggccgcagtggcccggaggccgagggcctgggctcagagactagccccacagtg
gatgacgaggaggagatgctgtatggggattcgggctccctcttcagccccagcaaggag
gaggcccgaagaagcagccagccccctgctgaccgggaccctgcacccttccgggcagag
cctacccactggtgcctgctggtgcgggagaatggcaccatggagatctaccagcttccc
gactggcggctggtgttcctggtgaagaacttccctgtggggcagcgggtccttgtggac
agctcctttggacagcccactacacagggcgaggcccgcagggaggaggccacgcgccag
ggggagctgcccctcgtcaaggaggtgctgctggtggcgctgggcagccgccagagcagg
ccctacctgctggtgcatgtggaccaagagctgcttatctacgaggccttcccccacgac
tctcagctcggccagggcaatctcaaagtccgctttaagaaggtccctcacaacatcaac
ttccgtgagaagaagccaaagccatccaagaagaaagcagaaggtggcggcgcagaggag
ggggctggggcccggggccgcgtggcgcgtttccgctacttcgaggatatttatggctac
tcaggggtcttcatctgcggcccctcccctcactggctcttggtgaccggccgaggggct
ctgcggctacaccccatggccatcgacggcccggtcgactctttcgctccattccacaat
gtcaactgtccccgcggcttcctgtacttcaacagacagggcgagctgaggatcagtgtc
ctgcctgcctacctgtcctatgatgccccatggcctgtcaggaagatcccgctgcgctgc
acggcccactatgtggcttaccacgtggagtctaaggtgtatgctgtggccaccagcacc
aacacgccgtgtgcccgcatcccacgcatgactggcgaggagaaggagtttgagaccatc
gagagagatgagcggtacatccacccccagcaggaggccttctccatccagctcatctcc
ccggtcagctgggaggctattcccaatgccaggatcgagctgcaggagtgggagcatgtg
acctgcatgaagacagtgtctctgcgcagtgaggagaccgtgtcgggcctcaaaggctac
gtggccgccgggacctgcctcatgcagggggaggaggtcacgtgccgagggcggatcttg
atcatggatgtgattgaggtggtgcccgagcctggccagcccttgaccaagaacaagttc
aaagtcctttacgagaaggagcagaaggggcccgtgaccgccctgtgccactgcaatggc
cacctggtgtcggccatcggccagaagattttcctgtggagcctgcgggccagcgagctg
acgggcatggccttcatcgacacgcagctctacatacaccagatgatcagcgtcaagaac
ttcatcctggcagccgacgtcatgaagagcatttcgctgctgcgctaccaggaggaaagc
aagacgctgagcctggtgtcgcgggatgccaagcccctggaggtgtacagcgtggacttc
atggtggacaatgcccagctgggttttctggtgtctgaccgcgaccgcaacctcatggtg
tacatgtacctgcccgaagccaaggagagtttcgggggcatgcgcctgctgcgtcgggca
gacttccacgtgggtgcccacgtgaacacgttctggaggaccccgtgccggggggccact
gaagggctcagcaaaaagtcggtcgtgtgggagaataagcacatcacgtggtttgccacc
ctggacggcggcatcgggctgctgctgcccatgcaggagaagacctaccggcggctgctg
atgctgcagaacgcgctgaccaccatgctgccacaccacgccggcctcaacccccgcgcc
ttccggatgctgcacgtggaccgccgcaccctccagaatgccgtgcgcaacgtgctggat
ggggagctgctcaaccgctacctgtacctgagcaccatggagcgcagcgagctagccaag
aagatcggcaccacaccagacataatcctggacgacttgctggagacggaccgcgtcacc
gcccacttctag

DBGET integrated database retrieval system