KEGG   Homo sapiens (human): 29895Help
Entry
29895             CDS       T01001                                 

Gene name
MYLPF, HUMMLC2B, MLC2B, MRLC2, MYL11
Definition
(RefSeq) myosin light chain, phosphorylatable, fast skeletal muscle
  KO
K12758  
fast skeletal myosin light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    29895 (MYLPF)
  Cell motility
   04810 Regulation of actin cytoskeleton
    29895 (MYLPF)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    29895 (MYLPF)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     29895 (MYLPF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   29895 (MYLPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96A32(Tbio)
UniProt: 
Position
16p11.2
AA seq 169 aa AA seqDB search
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc
atgttcgaccagactcagatccaggagttcaaagaggccttcactgtgatcgaccagaac
cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc
aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc
accgtcttcctgaccatgttcggggagaagctcaagggtgccgaccctgaggatgtgatc
accggagccttcaaggtcttggaccctgagggaaagggcaccatcaagaagaagttcctg
gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg
gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc
acgcacggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system