KEGG   Homo sapiens (human): 29895Help
Entry
29895             CDS       T01001                                 

Gene name
MYLPF, HUMMLC2B, MRLC2, MYL11
Definition
myosin light chain, phosphorylatable, fast skeletal muscle
Orthology
K12758  
fast skeletal myosin light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 169 aa AA seqDB search
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc
atgttcgaccagactcagatccaggagttcaaagaggccttcactgtgatcgaccagaac
cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc
aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc
accgtcttcctgaccatgttcggggagaagctcaagggtgccgaccctgaggatgtgatc
accggagccttcaaggtcttggaccctgagggaaagggcaccatcaagaagaagttcctg
gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg
gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc
acgcacggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system