KEGG   Homo sapiens (human): 29896Help
Entry
29896             CDS       T01001                                 

Gene name
TRA2A, AWMS1, HSU53209
Definition
transformer 2 alpha homolog (Drosophila)
Orthology
K12897  
transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15.3
AA seq 181 aa AA seqDB search
MSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRG
FAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGG
GGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRR
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccggagaagacatactggcagcagggcaaatccagatcccaacacttgcctt
ggagtgtttggcctcagtttgtacacaacagagagggatcttcgtgaagtattttctcga
tatggaccattgagtggtgtcaatgtggtttatgatcagcgaactgggcgatctcgagga
tttgcttttgtgtattttgagagaatagatgactcaaaggaggctatggaaagggcaaat
ggaatggagctggatggtagaagaattcgggtggattattctataaccaagagagcgcac
acaccaacaccaggcatctacatgggcagaccaactcatagtggtgggggtggtggagga
ggcggcggcggtggaggtggaggtggtggcagacgtcgagattcttactatgatagagga
tatgatcgtgggtatgacagatatgaagactatgattaccgatacagaagacgatcacct
tctccttattatagtcgatatagatcacgatcaagatctcgttcctacagcccaagacgc
tattga

DBGET integrated database retrieval system