KEGG   Homo sapiens (human): 29906Help
Entry
29906             CDS       T01001                                 

Gene name
ST8SIA5, SIAT8-E, SIAT8E, ST8SiaV
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5 (EC:2.4.99.-)
  KO
K03369  
alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8E) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    29906 (ST8SIA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     29906 (ST8SIA5)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   29906 (ST8SIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 412 aa AA seqDB search
MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRGLQFGWQSGDQLTNWT
GLFNVTDDPAVQSGSDSSSRYFEFYEGPFEYNSTRCLELRHEILEVKVLSMVKQSELFDR
WKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTTQKNTPLGTKLKYEVDTSGIYHINQ
EIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGREINSADFVFRCNLPPISEKYTMDV
GVKTDVVTVNPSIITERFHKLEKWRRPFYRVLQVYENASVLLPAFYNTRNTDVSIRVKYV
LDDFESPQAVYYFHPQYLVNVSRYWLSLGVRAKRISTGLILVTAALELCEEVHLFGFWAF
PMNPSGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCSCC
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgcggacccctcggccaaccgggatttgttggggagccgaactttgctcttc
atcttcatctgcgcctttgccttggtgaccttgctgcaacagatcctgtatggcaggaac
tacattaagagaggcctccagtttggttggcagagtggtgaccagctgaccaattggacg
gggctctttaatgtcacggatgatccagcagtgcagagcggcagtgactccagctccagg
tactttgaattttatgaggggccttttgaatataactccacaagatgcctggagctgagg
cacgaaatattggaagtgaaggtgctgtccatggtgaagcagtcagagctgttcgacagg
tggaagagcctccagatgtgcaaatgggcgatgaacatctctgaggccaaccagttcaag
tctactctgtccaggtgctgcaacgcccctgcctttctcttcaccacccagaagaacact
cccctggggacaaagctcaagtatgaggtggacaccagtggcatctaccacatcaaccag
gagatcttccgcatgtttcccaaggacatgccctactaccggtcccagtttaagaagtgt
gctgtagtgggcaacggaggcatcttgaagaacagccgctgcgggagggagatcaacagc
gccgacttcgtcttccggtgcaacctgccccccatctcagagaagtacaccatggatgtg
ggggtgaagacggatgtggtcactgtgaaccccagcatcatcacagagaggttccacaag
ctggagaagtggcggcggccgttctatcgcgtgctgcaggtgtacgagaacgcgtcggtg
ctgctgcctgccttctacaacacgcgcaacaccgacgtgtccatccgcgtcaagtacgtg
ctggacgacttcgaatcgccgcaagctgtctactacttccatccgcagtacctggtcaac
gtgtcgcgctactggctcagcctgggggtgcgcgccaagcgcatcagcaccggcctcatt
ctggtcactgcggcgctggagctctgtgaggaggtgcacctctttggcttctgggccttc
cccatgaacccctcgggcctctacatcactcaccactactatgacaacgtcaagccgcgt
cccggcttccacgccatgccctctgagatcttcaacttcctgcacttgcacagccgaggc
atcctccgcgtgcacacgggcacctgcagctgctgctga

DBGET integrated database retrieval system