KEGG   Homo sapiens (human): 29906Help
Entry
29906             CDS       T01001                                 

Gene name
ST8SIA5, SIAT8E, ST8SiaV
Definition
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5 (EC:2.4.99.-)
Orthology
K03369  
alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8E) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:hsa00604]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 376 aa AA seqDB search
MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRC
LELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTT
QKNTPLGTKLKYEVDTSGIYHINQEIFRMFPKDMPYYRSQFKKCAVVGNGGILKNSRCGR
EINSADFVFRCNLPPISEKYTMDVGVKTDVVTVNPSIITERFHKLEKWRRPFYRVLQVYE
NASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQYLVNVSRYWLSLGVRAKRIS
TGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAMPSEIFNFLHL
HSRGILRVHTGTCSCC
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgcggacccctcggccaaccgggatttgttggggagccgaactttgctcttc
atcttcatctgcgcctttgccttggtgaccttgctgcaacagatcctgtatggcaggaac
tacattaagaggtactttgaattttatgaggggccttttgaatataactccacaagatgc
ctggagctgaggcacgaaatattggaagtgaaggtgctgtccatggtgaagcagtcagag
ctgttcgacaggtggaagagcctccagatgtgcaaatgggcgatgaacatctctgaggcc
aaccagttcaagtctactctgtccaggtgctgcaacgcccctgcctttctcttcaccacc
cagaagaacactcccctggggacaaagctcaagtatgaggtggacaccagtggcatctac
cacatcaaccaggagatcttccgcatgtttcccaaggacatgccctactaccggtcccag
tttaagaagtgtgctgtagtgggcaacggaggcatcttgaagaacagccgctgcgggagg
gagatcaacagcgccgacttcgtcttccggtgcaacctgccccccatctcagagaagtac
accatggatgtgggggtgaagacggatgtggtcactgtgaaccccagcatcatcacagag
aggttccacaagctggagaagtggcggcggccgttctatcgcgtgctgcaggtgtacgag
aacgcgtcggtgctgctgcctgccttctacaacacgcgcaacaccgacgtgtccatccgc
gtcaagtacgtgctggacgacttcgaatcgccgcaagctgtctactacttccatccgcag
tacctggtcaacgtgtcgcgctactggctcagcctgggggtgcgcgccaagcgcatcagc
accggcctcattctggtcactgcggcgctggagctctgtgaggaggtgcacctctttggc
ttctgggccttccccatgaacccctcgggcctctacatcactcaccactactatgacaac
gtcaagccgcgtcccggcttccacgccatgccctctgagatcttcaacttcctgcacttg
cacagccgaggcatcctccgcgtgcacacgggcacctgcagctgctgctga

DBGET integrated database retrieval system