KEGG   Homo sapiens (human): 29909Help
Entry
29909             CDS       T01001                                 

Gene name
GPR171, H963
Definition
(RefSeq) G protein-coupled receptor 171
  KO
K08441  
G protein-coupled receptor 171
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    29909 (GPR171)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.1
AA seq 319 aa AA seqDB search
MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTAD
FLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSC
KIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLT
NFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINILLVTTGYIICFVPYH
IVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRSKVTETF
ASPKETKAQKEKLRCENNA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacagttcgttcttctgcccagtttataaagatctggagccattcacgtatttt
ttttatttagttttccttgttggaattattggaagttgttttgcaacctgggcttttata
cagaagaatacgaatcacaggtgtgtgagcatctacttaattaatttgcttacagccgat
ttcctgcttactctggcattaccagtgaaaattgttgttgacttgggtgtggcaccttgg
aagctgaagatattccactgccaagtaacagcctgcctcatctatatcaatatgtattta
tcaattatcttcttagcatttgtcagcattgaccgctgtcttcagctgacacacagctgc
aagatctaccgaatacaagaacccggatttgccaaaatgatatcaaccgttgtgtggcta
atggtccttcttataatggtgccaaatatgatgattcccatcaaagacatcaaggaaaag
tcaaatgtgggttgtatggagtttaaaaaggaatttggaagaaattggcatttgctgaca
aatttcatatgtgtagcaatatttttaaatttctcagccatcattttaatatccaattgc
cttgtaattcgacagctctacagaaacaaagataatgaaaattacccaaatgtgaaaaag
gctctcatcaacatacttttagtgaccacgggctacatcatatgctttgttccttaccac
attgtccgaatcccgtataccctcagccagacagaagtcataactgattgctcaaccagg
atttcactcttcaaagccaaagaggctacactgctcctggctgtgtcgaacctgtgcttt
gatcctatcctgtactatcacctctcaaaagcattccgctcaaaggtcactgagactttt
gcctcacctaaagagaccaaggctcagaaagaaaaattaagatgtgaaaataatgcataa

DBGET integrated database retrieval system