KEGG   Homo sapiens (human): 29945Help
Entry
29945             CDS       T01001                                 

Gene name
ANAPC4, APC4
Definition
anaphase promoting complex subunit 4
Orthology
K03351  
anaphase-promoting complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29945 (ANAPC4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    29945 (ANAPC4)
   04114 Oocyte meiosis
    29945 (ANAPC4)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29945 (ANAPC4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    29945 (ANAPC4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     29945 (ANAPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.2
AA seq 809 aa AA seqDB search
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKVMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYL
KDEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQK
PADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMC
ILRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGR
EGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKA
QYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSES
EAENQQAGAAALAPEIVIKVEKLDPELDS
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttttccgacctgtttcccatccttccgggtggtgggagagaagcagctcccg
caggagattattttcctggtctggtcgcccaagcgggatctcattgctttggccaacaca
gctggcgaggttttacttcatcgactggcaagttttcatcgagtttggagttttccacca
aatgaaaatacaggaaaggaggtgacgtgtctggcatggagaccagatggcaaacttttg
gcctttgctcttgctgataccaagaaaattgttttgtgtgatgtagaaaaacctgagagc
ttacactctttttctgtggaggctccagtttcctgtatgcattggatggaagtgacagta
gaaagcagtgttctcacatcattttataatgctgaggatgaatcaaatcttctcttacct
aaactacctacactgccaaaaaactatagcaacacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagctcttgggagacgtcaggcttaatattctcgtccttggagga
agctctggatttattgagctttatgcttatggaatgtttaaaattgctcgagtcacaggg
attgctggtacttgtcttgcattatgtttatcaagtgatttgaaatcattatcagtggtc
acagaagtctctaccaatggtgcttcagaagtttcatactttcagcttgaaactaatctg
ttgtactctttcttacctgaagtaactcggatggccagaaagtttactcatatttcagct
ctgttacagtatataaatttgtcactaacatgtatgtgtgaagcatgggaagaaatacta
atgcagatggattctcgtctcaccaagtttgtgcaggaaaagaacacaaccacatcagtg
caagatgagttcatgcacttgctattatgggggaaagcaagtgctgaacttcagactctc
ttgatgaatcagttaacagtaaagggcttgaaaaagcttggccagtctatagagtcatca
tactccagtatacaaaaattggtcataagtcatttacagagtggctcggagtctttatta
taccatttgagtgaattgaaaggaatggcttcatggaagcaaaaatatgaacctcttgga
ctagatgctgcaggaatcgaagaagctataactgctgtgggttcttttatactcaaggca
aatgaacttcttcaagttatagatagtagtatgaaaaacttcaaagcattttttcggtgg
ctttatgtggcaatgttgagaatgacagaagaccatgtgcttcccgagctgaataaggta
atgactcagaaagatatcacatttgttgctgaatttcttactgaacatttcaatgaggct
ccagacctttataatcgaaaaggaaaatactttaacgttgaaagagttggtcagtacttg
aaagatgaagatgatgatcttgtgtcaccccctaacacagaaggaaaccagtggtatgac
tttcttcaaaatagcagccaccttaaagaaagtcctttgctgtttccttattatcctcga
aaatcattgcattttgtgaaaaggcggatggagaatattattgatcagtgtttgcaaaag
ccagcagatgtaattggaaaatcgatgaatcaagcaatctgtattccattgtatagagat
accagaagtgaggattctacacgtagattgttcaaatttccttttctgtggaataataaa
acttcaaatctacattatcttctttttactattctagaagattcactttataaaatgtgc
atcttaaggagacatactgatatttctcaatctgtgagtaatggactaattgctattaaa
tttgggagctttacatatgccacaacagaaaaagtcagaagaagcatctacagttgttta
gatgcacagttttatgatgatgaaactgtaacagtagttcttaaagacactgtaggacgt
gaaggaagagatagactcttggtccagctgcctttgtctttagtatataacagtgaagat
tctgcagaatatcagttcactgggacttattctacaaggctagatgaacagtgtagtgct
attcccacccgtaccatgcattttgagaagcactggagattactggaaagtatgaaagca
cagtatgttgctgggaatggttttcgaaaagtgtcctgtgtgttaagctcaaatcttcgt
catgtgagagtatttgaaatggacatagatgatgaatgggagctcgatgagtcttcagat
gaagaggaggaggccagtaataagcctgtaaaaataaaggaagaagtgttgtcggagtca
gaggcagagaaccaacaagctggtgctgccgctttagctccagagatagtcattaaagtg
gaaaaacttgaccctgagctagactcctaa

DBGET integrated database retrieval system